Anti-5HT3A receptor Picoband Antibody
- SPECIFICATION
- CITATIONS
- PROTOCOLS
- BACKGROUND
Application
| WB |
---|---|
Primary Accession | P46098 |
Host | Rabbit |
Reactivity | Human, Mouse, Rat |
Clonality | Polyclonal |
Format | Lyophilized |
Description | Rabbit IgG polyclonal antibody for 5-hydroxytryptamine receptor 3A(HTR3A) detection. Tested with WB in Human;Mouse;Rat. |
Reconstitution | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Gene ID | 3359 |
---|---|
Other Names | 5-hydroxytryptamine receptor 3A, 5-HT3-A, 5-HT3A, 5-hydroxytryptamine receptor 3, 5-HT-3, 5-HT3R, Serotonin receptor 3A, Serotonin-gated ion channel receptor, HTR3A, 5HT3R, HTR3 |
Calculated MW | 55280 MW KDa |
Application Details | Western blot, 0.1-0.5 µg/ml, Human, Mouse, Rat |
Subcellular Localization | Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. |
Tissue Specificity | Expressed in cerebral cortex, amygdala, hippocampus, and testis. Detected in monocytes of the spleen and tonsil, in small and large intestine, uterus, prostate, ovary and placenta. . |
Protein Name | 5-hydroxytryptamine receptor 3A |
Contents | Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3. |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human 5HT3A receptor (72-108aa NVDEKNQVLTTYIWYRQYWTDEFLQWNPEDFDNITK L), different from the related mouse sequence by two amino acids, and from the related rat sequence by three amino aci |
Purification | Immunogen affinity purified. |
Cross Reactivity | No cross reactivity with other proteins. |
Storage | At -20˚C for one year. After r˚Constitution, at 4˚C for one month. It˚Can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing. |
Name | HTR3A (HGNC:5297) |
---|---|
Synonyms | 5HT3R, HTR3 |
Function | Forms serotonin (5-hydroxytryptamine/5-HT3)-activated cation- selective channel complexes, which when activated cause fast, depolarizing responses in neurons. |
Cellular Location | Postsynaptic cell membrane; Multi-pass membrane protein {ECO:0000250|UniProtKB:P23979}. Cell membrane; Multi-pass membrane protein {ECO:0000250|UniProtKB:P23979} |
Tissue Location | Expressed in cerebral cortex, amygdala, hippocampus, and testis. Detected in monocytes of the spleen and tonsil, in small and large intestine, uterus, prostate, ovary and placenta. |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
info@abcepta.com, and receive a free "I Love Antibodies" mug.
Provided below are standard protocols that you may find useful for product applications.
Background
5-hydroxytryptamine receptor 3A is a protein that in humans is encoded by the HTR3A gene. The product of this gene belongs to the ligand-gated ion channel receptor superfamily. This gene encodes subunit A of the type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor causes fast, depolarizing responses in neurons after activation. It appears that the heteromeric combination of A and B subunits is necessary to provide the full functional features of this receptor, since either subunit alone results in receptors with very low conductance and response amplitude. Alternatively spliced transcript variants encoding different isoforms have been identified.
If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.
If you have any additional inquiries please email technical services at tech@abcepta.com.