Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
COVID19
>   home   >   Products   >   Primary Antibodies   >   Signal Transduction   >   Anti-liver FABP Picoband Antibody   

Anti-liver FABP Picoband Antibody

     
  • WB - Anti-liver FABP Picoband Antibody ABO12272
    Anti- liver FABP Picoband antibody, ABO12272, Western blottingAll lanes: Anti liver FABP (ABO12272) at 0.5ug/mlLane 1: Rat Liver Tissue Lysate at 50ugLane 2: Mouse Liver Tissue Lysate at 50ugLane 3: SMMC Whole Cell Lysate at 40ugLane 4: HEPG2 Whole Cell Lysate at 40ugLane 5: RH35 Whole Cell Lysate at 40ugPredicted bind size: 14KDObserved bind size: 14KD
    detail
  • IHC - Anti-liver FABP Picoband Antibody ABO12272
    Anti- liver FABP Picoband antibody, ABO12272,IHC(P)IHC(P): Mouse Intestine Tissue
    detail
  • IHC - Anti-liver FABP Picoband Antibody ABO12272
    Anti- liver FABP Picoband antibody, ABO12272,IHC(P)IHC(P): Rat Intestine Tissue
    detail
  • IHC - Anti-liver FABP Picoband Antibody ABO12272
    Anti- liver FABP Picoband antibody, ABO12272,IHC(P)IHC(P): Human Intestinal Cancer Tissue
    detail
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
  • detail
Product Information
Application
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • E=ELISA
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immuno electron microscopy
  • EIA=Enzyme Immunoassay
WB, IHC-P
Primary Accession P07148
Host Rabbit
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Format Lyophilized
Description Rabbit IgG polyclonal antibody for Fatty acid-binding protein, liver(FABP1) detection. Tested with WB, IHC-P in Human;Mouse;Rat.
Reconstitution Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Additional Information
Gene ID 2168
Other Names Fatty acid-binding protein, liver, Fatty acid-binding protein 1, Liver-type fatty acid-binding protein, L-FABP, FABP1, FABPL
Calculated MW 14208 MW KDa
Application Details Immunohistochemistry(Paraffin-embedded Section), 0.5-1 µg/ml, Human, Mouse, Rat, By Heat

Western blot, 0.1-0.5 µg/ml, Human, Mouse, Rat
Subcellular Localization Cytoplasm.
Protein Name Fatty acid-binding protein, liver
Contents Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human liver FABP (6-36aa KYQLQSQENFEAFMKAIGLPEELIQKGKDIK), different from the related mouse sequence by two amino acids, and from the related rat sequence by four amino acids.
Purification Immunogen affinity purified.
Cross Reactivity No cross reactivity with other proteins
Storage At -20˚C for one year. After r˚Constitution, at 4˚C for one month. It˚Can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Information
Name FABP1
Synonyms FABPL
Function Plays a role in lipoprotein-mediated cholesterol uptake in hepatocytes (PubMed:25732850). Binds cholesterol (PubMed:25732850). Binds free fatty acids and their coenzyme A derivatives, bilirubin, and some other small molecules in the cytoplasm. May be involved in intracellular lipid transport (By similarity).
Cellular Location Cytoplasm.
Research Areas
Citations (0)
citation

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abcepta antibody to
info@abcepta.com, and receive a free "I Love Antibodies" mug.

Background

Fatty acid binding protein 1, liver, also known as FABP1 or FABPL, is a human gene locating at 2p11. FABP1 encodes the fatty acid binding protein found in liver. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind free fatty acids, their CoA derivatives, bilirubin, organic anions, and other small molecules. FABP1 and FABP6 (the ileal fatty acid binding protein) are also able to bind bile acids. It is thought that FABPs roles include fatty acid uptake, transport, and metaboism. The liver form of FABP may be identical to the major liver protein-1 (Lvp-1), which is encoded by a gene situated within 1 cM of Ly-2.

FeedBack
Abcepta welcomes feedback from its customers.

If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abcepta.com.

$ 370.00
Cat# ABO12272
Size:
Quantity:
Availability: 3-5 days
Bulk Size

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaMexicoNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abcepta, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Terms & Conditions
"