Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Primary Antibodies   >   Antibody Collections   >   Goat Antibodies   >   PPP2R3A Antibody (internal region)   

PPP2R3A Antibody (internal region)

Peptide-affinity purified goat antibody

     
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
Product Information
Application
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • E=ELISA
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
E
Primary Accession Q06190
Other Accession NP_002709.2, NP_871626.1, 5523
Predicted Human
Host Goat
Clonality Polyclonal
Concentration 0.5 mg/ml
Isotype IgG
Additional Information
Other Names Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha, PP2A subunit B isoform PR72/PR130, PP2A subunit B isoform R3 isoform, PP2A subunit B isoforms B''-PR72/PR130, PP2A subunit B isoforms B72/B130, Serine/threonine-protein phosphatase 2A 72/130 kDa regulatory subunit B, PPP2R3A, PPP2R3
Format 0.5 mg/ml in Tris saline, 0.02% sodium azide, pH7.3 with 0.5% bovine serum albumin
StorageMaintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
PrecautionsPPP2R3A Antibody (internal region) is for research use only and not for use in diagnostic or therapeutic procedures.
Protein Information
Name PPP2R3A
Synonyms PPP2R3
Function The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment.
Tissue Location Expressed in heart, brain, placenta, lung, muscle and kidney EMBL; L07590; AAB02613.1; -; mRNA EMBL; L12146; AAB02614.1; -; mRNA EMBL; AK293012; BAF85701.1; -; mRNA EMBL; AK298059; BAG60353.1; -; mRNA EMBL; AK316258; BAH14629.1; -; mRNA EMBL; AC072039; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; AC092991; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; CH471052; EAW79122.1; -; Genomic_DNA EMBL; CH471052; EAW79123.1; -; Genomic_DNA EMBL; AL389975; CAB97532.1; -; mRNA CCDS; CCDS3087.1; -. [Q06190-1] CCDS; CCDS3088.1; -. [Q06190-2] CCDS; CCDS54642.1; -. [Q06190-3] PIR; A47114; A47114 PIR; B47114; B47114 RefSeq; NP_001177376.1; NM_001190447.1. [Q06190-3] RefSeq; NP_002709.2; NM_002718.4. [Q06190-1] RefSeq; NP_871626.1; NM_181897.2. [Q06190-2] RefSeq; XP_006713749.1; XM_006713686.3. [Q06190-1] RefSeq; XP_011511258.1; XM_011512956.2. [Q06190-1] PDB; 4I5J; X-ray; 2.09 A; A=786-1070 PDB; 4I5K; X-ray; 2.90 A; A/B=786-1070 PDBsum; 4I5J; - PDBsum; 4I5K; - SMR; Q06190; - BioGrid; 111515; 34 CORUM; Q06190; - DIP; DIP-29397N; - IntAct; Q06190; 22 MINT; Q06190; - STRING; 9606.ENSP00000264977; - iPTMnet; Q06190; - PhosphoSitePlus; Q06190; - BioMuta; PPP2R3A; - DMDM; 543720; - EPD; Q06190; - jPOST; Q06190; - MassIVE; Q06190; - MaxQB; Q06190; - PaxDb; Q06190; - PeptideAtlas; Q06190; - PRIDE; Q06190; - ProteomicsDB; 4724; - ProteomicsDB; 58420; -. [Q06190-1] ProteomicsDB; 58421; -. [Q06190-2] Antibodypedia; 33406; 223 antibodies Ensembl; ENST00000264977; ENSP00000264977; ENSG00000073711. [Q06190-1] Ensembl; ENST00000334546; ENSP00000334748; ENSG00000073711. [Q06190-2] Ensembl; ENST00000490467; ENSP00000419344; ENSG00000073711. [Q06190-3] GeneID; 5523; - KEGG; hsa:5523; - UCSC; uc003eqv.3; human. [Q06190-1] CTD; 5523; - DisGeNET; 5523; - GeneCards; PPP2R3A; - HGNC; HGNC:9307; PPP2R3A HPA; ENSG00000073711; Tissue enhanced (skeletal) MIM; 604944; gene neXtProt; NX_Q06190; - OpenTargets; ENSG00000073711; - PharmGKB; PA35523; - eggNOG; KOG2562; Eukaryota eggNOG; ENOG410XRBK; LUCA GeneTree; ENSGT00940000154659; - HOGENOM; CLU_276803_0_0_1; - KO; K11583; - OMA; AHHSVCA; - OrthoDB; 255081at2759; - PhylomeDB; Q06190; - TreeFam; TF105554; - ChiTaRS; PPP2R3A; human GeneWiki; PPP2R3A; - GenomeRNAi; 5523; - Pharos; Q06190; Tbio PRO; PR:Q06190; - Proteomes; UP000005640; Chromosome 3 RNAct; Q06190; protein Bgee; ENSG00000073711; Expressed in biceps brachii and 237 other tissues ExpressionAtlas; Q06190; baseline and differential Genevisible; Q06190; HS GO; GO:0000159; C:protein phosphatase type 2A complex; IDA:BHF-UCL GO; GO:0005509; F:calcium ion binding; IEA:InterPro GO; GO:0030674; F:protein binding, bridging; IDA:BHF-UCL GO; GO:0019888; F:protein phosphatase regulator activity; IBA:GO_Central GO; GO:0001754; P:eye photoreceptor cell differentiation; IGI:BHF-UCL GO; GO:0090090; P:negative regulation of canonical Wnt signaling pathway; IGI:BHF-UCL GO; GO:0090263; P:positive regulation of canonical Wnt signaling pathway; IDA:BHF-UCL GO; GO:0045732; P:positive regulation of protein catabolic process; IMP:BHF-UCL GO; GO:0006470; P:protein dephosphorylation; ISS:UniProtKB GO; GO:0090249; P:regulation of cell motility involved in somitogenic axis elongation; IGI:BHF-UCL GO; GO:0007525; P:somatic muscle development; IGI:BHF-UCL GO; GO:0061053; P:somite development; ISS:BHF-UCL GO; GO:0090244; P:Wnt signaling pathway involved in somitogenesis; IC:BHF-UCL InterPro; IPR011992; EF-hand-dom_pair InterPro; IPR041534; EF-hand_13 InterPro; IPR018247; EF_Hand_1_Ca_BS InterPro; IPR002048; EF_hand_dom Pfam; PF17958; EF-hand_13; 1 Pfam; PF13499; EF-hand_7; 1 SUPFAM; SSF47473; SSF47473; 2 PROSITE; PS00018; EF_HAND_1; 1 PROSITE; PS50222; EF_HAND_2; 2 1: Evidence at protein level; 3D-structure; Alternative splicing; Calcium; Direct protein sequencing; Metal-binding; Polymorphism; Reference proteome; Repeat CHAIN 1..1150 /note="Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha" /id="PRO_0000071443" DOMAIN 758..793 /note="EF-hand 1" /evidence="ECO:0000255|PROSITE-ProRule:PRU00448" DOMAIN 972..1007 /note="EF-hand 2" /evidence="ECO:0000255|PROSITE-ProRule:PRU00448" CA_BIND 985..996 /evidence="ECO:0000255|PROSITE-ProRule:PRU00448" COMPBIAS 670..695 /note="Pro-rich" VAR_SEQ 1..736 /note="Missing (in isoform 3)" /evidence="ECO:0000303|PubMed:14702039" /id="VSP_045203" VAR_SEQ 1..621 /note="Missing (in isoform PR72)" /evidence="ECO:0000303|PubMed:14702039, ECO:0000303|PubMed:8392071" /id="VSP_005107" VAR_SEQ 622..665 /note="MQILQETLTTSSQANLSVCRSPVGDKAKDTTSAVLIQQTPEVIK -> MMIK ETSLRRDPDLRGELAFLARGCDFVLPSRFKKRLKSFQQTQ (in isoform PR72)" /evidence="ECO:0000303|PubMed:14702039, ECO:0000303|PubMed:8392071" /id="VSP_005108" VARIANT 67 /note="D -> G (in dbSNP:rs9814557)" /id="VAR_051739" VARIANT 67 /note="D -> N (in dbSNP:rs57374999)" /id="VAR_061760" VARIANT 108 /note="N -> S (in dbSNP:rs36020282)" /id="VAR_051740" VARIANT 171 /note="A -> S (in dbSNP:rs6779903)" /id="VAR_051741" VARIANT 481 /note="P -> A (in dbSNP:rs34901937)" /id="VAR_051742" VARIANT 642 /note="S -> G (in dbSNP:rs17197552)" /id="VAR_051743" VARIANT 695 /note="P -> L (in dbSNP:rs9826032)" /id="VAR_051744" VARIANT 745 /note="D -> N (in dbSNP:rs16843645)" /id="VAR_022095" HELIX 797..805 /evidence="ECO:0000244|PDB:4I5J" STRAND 811..813 /evidence="ECO:0000244|PDB:4I5J" HELIX 815..818 /evidence="ECO:0000244|PDB:4I5J" HELIX 819..828 /evidence="ECO:0000244|PDB:4I5J" TURN 830..832 /evidence="ECO:0000244|PDB:4I5J" HELIX 833..837 /evidence="ECO:0000244|PDB:4I5J" HELIX 839..857 /evidence="ECO:0000244|PDB:4I5J" STRAND 861..863 /evidence="ECO:0000244|PDB:4I5K" HELIX 867..871 /evidence="ECO:0000244|PDB:4I5J" HELIX 875..882 /evidence="ECO:0000244|PDB:4I5J" HELIX 888..890 /evidence="ECO:0000244|PDB:4I5J" TURN 892..895 /evidence="ECO:0000244|PDB:4I5J" HELIX 897..910 /evidence="ECO:0000244|PDB:4I5J" STRAND 915..919 /evidence="ECO:0000244|PDB:4I5K" HELIX 920..923 /evidence="ECO:0000244|PDB:4I5J" TURN 924..929 /evidence="ECO:0000244|PDB:4I5J" HELIX 933..939 /evidence="ECO:0000244|PDB:4I5J" TURN 940..944 /evidence="ECO:0000244|PDB:4I5J" HELIX 958..969 /evidence="ECO:0000244|PDB:4I5J" HELIX 974..984 /evidence="ECO:0000244|PDB:4I5J" STRAND 989..992 /evidence="ECO:0000244|PDB:4I5J" HELIX 994..1010 /evidence="ECO:0000244|PDB:4I5J" HELIX 1018..1029 /evidence="ECO:0000244|PDB:4I5J" HELIX 1039..1045 /evidence="ECO:0000244|PDB:4I5J" HELIX 1048..1056 /evidence="ECO:0000244|PDB:4I5J" HELIX 1058..1062 /evidence="ECO:0000244|PDB:4I5J" SEQUENCE 1150 AA; 130278 MW; 97A31BA4206518A3 CRC64; MAATYRLVVS TVNHYSSVVI DRRFEQAIHY CTGTCHTFTH GIDCIVVHHS VCADLLHIPV SQFKDADLNS MFLPHENGLS SAEGDYPQQA FTGIPRVKRG STFQNTYNLK DIAGEAISFA SGKIKEFSFE KLKNSNHAAY RKGRKVKSDS FNRRSVDLDL LCGHYNNDGN APSFGLLRSS SVEEKPLSHR NSLDTNLTSM FLQNFSEEDL VTQILEKHKI DNFSSGTDIK MCLDILLKCS EDLKKCTDII KQCIKKKSGS SISEGSGNDT ISSSETVYMN VMTRLASYLK KLPFEFMQSG NNEALDLTEL ISNMPSLQLT PFSPVFGTEQ PPKYEDVVQL SASDSGRFQT IELQNDKPNS RKMDTVQSIP NNSTNSLYNL EVNDPRTLKA VQVQSQSLTM NPLENVSSDD LMETLYIEEE SDGKKALDKG QKTENGPSHE LLKVNEHRAE FPEHATHLKK CPTPMQNEIG KIFEKSFVNL PKEDCKSKVS KFEEGDQRDF TNSSSQEEID KLLMDLESFS QKMETSLREP LAKGKNSNFL NSHSQLTGQT LVDLEPKSKV SSPIEKVSPS CLTRIIETNG HKIEEEDRAL LLRILESIED FAQELVECKS SRGSLSQEKE MMQILQETLT TSSQANLSVC RSPVGDKAKD TTSAVLIQQT PEVIKIQNKP EKKPGTPLPP PATSPSSPRP LSPVPHVNNV VNAPLSINIP RFYFPEGLPD TCSNHEQTLS RIETAFMDIE EQKADIYEMG KIAKVCGCPL YWKAPMFRAA GGEKTGFVTA QSFIAMWRKL LNNHHDDASK FICLLAKPNC SSLEQEDFIP LLQDVVDTHP GLTFLKDAPE FHSRYITTVI QRIFYTVNRS WSGKITSTEI RKSNFLQTLA LLEEEEDINQ ITDYFSYEHF YVIYCKFWEL DTDHDLYISQ ADLSRYNDQA SSSRIIERIF SGAVTRGKTI QKEGRMSYAD FVWFLISEED KRNPTSIEYW FRCMDVDGDG VLSMYELEYF YEEQCERMEA MGIEPLPFHD LLCQMLDLVK PAVDGKITLR DLKRCRMAHI FYDTFFNLEK YLDHEQRDPF AVQKDVENDG PEPSDWDRFA AEEYETLVAE ESAQAQFQEG FEDYETDEPA SPSEFGNKSN KILSASLPEK CGKLQSVDEE
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abcepta antibody to
info@abcepta.com, and receive a free "I Love Antibodies" mug.

Background

This antibody is expected to recognise both reported isoforms (NP_002709.2; NP_871626.1).

References

Viable mice with compound mutations in the Wnt/Dvl pathway antagonists nkd1 and nkd2. Zhang S, Cagatay T, Amanai M, Zhang M, Kline J, Castrillon DH, Ashfaq R, Oz OK, Wharton KA Jr. Mol Cell Biol. 2007 Jun;27(12):4454-64. Epub 2007 Apr 16. PMID: 17438140

FeedBack
Abcepta welcomes feedback from its customers.

If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abcepta.com.

$ 368.00
Cat# AF2673a
Size:
Quantity:
Availability: 7-10 days
Bulk Size

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abcepta, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900
Cedarlane Labs
+1 (800) 721-1644
+1 (336) 513-5138

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Terms & Conditions
"