Register or Login
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Primary Antibodies   >   Neuroscience   >   GBX2 Antibody (Center)(Ascites)   

GBX2 Antibody (Center)(Ascites)

Mouse Monoclonal Antibody (Mab)

  • WB - GBX2 Antibody (Center)(Ascites) AM1997a
    GBX2 Antibody (Center) (Cat. #AM1997a) western blot analysis in human placenta tissue lysates (35μg/lane).This demonstrates the GBX2 antibody detected the GBX2 protein (arrow).
Product Information
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
Primary Accession P52951
Other Accession P48031, NP_001476.2
Reactivity Human
Predicted Mouse
Host Mouse
Clonality Monoclonal
Isotype IgM
Clone Names 385CT10.1.1
Antigen Region 103-131 aa
Additional Information
Other Names Homeobox protein GBX-2, Gastrulation and brain-specific homeobox protein 2, GBX2
Target/Specificity This GBX2 antibody is generated from mice immunized with a KLH conjugated synthetic peptide between 103-131 amino acids from the Central region of human GBX2.
Dilution WB~~1:4000~64000
Format Mouse monoclonal antibody supplied in crude ascites with 0.09% (W/V) sodium azide.
StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
PrecautionsGBX2 Antibody (Center)(Ascites) is for research use only and not for use in diagnostic or therapeutic procedures.
Protein Information
Name GBX2
Function May act as a transcription factor for cell pluripotency and differentiation in the embryo.
Cellular Location Nucleus. EMBL; U31468; AAC03241.1; -; Genomic_DNA EMBL; AF118452; AAD39907.1; -; mRNA EMBL; AC079135; AAX93240.1; -; Genomic_DNA EMBL; CH471063; EAW71084.1; -; Genomic_DNA EMBL; BC137448; AAI37449.1; -; mRNA EMBL; BC137449; AAI37450.1; -; mRNA EMBL; U02080; AAA17406.1; -; Genomic_DNA CCDS; CCDS2515.1; - PIR; S39540; S39540 RefSeq; NP_001476.2; NM_001485.3 UniGene; Hs.184945; - UniGene; Hs.735751; - ProteinModelPortal; P52951; - SMR; P52951; - BioGrid; 108907; 3 STRING; 9606.ENSP00000302251; - iPTMnet; P52951; - PhosphoSitePlus; P52951; - BioMuta; GBX2; - DMDM; 12644308; - EPD; P52951; - MaxQB; P52951; - PaxDb; P52951; - PeptideAtlas; P52951; - PRIDE; P52951; - ProteomicsDB; 56561; - Ensembl; ENST00000306318; ENSP00000302251; ENSG00000168505 GeneID; 2637; - KEGG; hsa:2637; - UCSC; uc002vvw.2; human CTD; 2637; - DisGeNET; 2637; - EuPathDB; HostDB:ENSG00000168505.6; - GeneCards; GBX2; - HGNC; HGNC:4186; GBX2 HPA; HPA067809; - MIM; 601135; gene neXtProt; NX_P52951; - OpenTargets; ENSG00000168505; - PharmGKB; PA28600; - eggNOG; KOG0489; Eukaryota eggNOG; ENOG410ZTBY; LUCA GeneTree; ENSGT00940000154365; - HOGENOM; HOG000060099; - HOVERGEN; HBG003967; - InParanoid; P52951; - KO; K09321; - OMA; FMPYRSV; - OrthoDB; 1406210at2759; - PhylomeDB; P52951; - TreeFam; TF351530; - GeneWiki; GBX2; - GenomeRNAi; 2637; - PRO; PR:P52951; - Proteomes; UP000005640; Chromosome 2 Bgee; ENSG00000168505; Expressed in 26 organ(s), highest expression level in cerebellum ExpressionAtlas; P52951; baseline and differential Genevisible; P52951; HS GO; GO:0005634; C:nucleus; IBA:GO_Central GO; GO:0001228; F:DNA-binding transcription activator activity, RNA polymerase II-specific; IBA:GO_Central GO; GO:0003700; F:DNA-binding transcription factor activity; TAS:ProtInc GO; GO:0000981; F:DNA-binding transcription factor activity, RNA polymerase II-specific; ISA:NTNU_SB GO; GO:0000979; F:RNA polymerase II core promoter sequence-specific DNA binding; IEA:Ensembl GO; GO:0000977; F:RNA polymerase II regulatory region sequence-specific DNA binding; IBA:GO_Central GO; GO:0048483; P:autonomic nervous system development; IEA:Ensembl GO; GO:0007411; P:axon guidance; IEA:Ensembl GO; GO:0001569; P:branching involved in blood vessel morphogenesis; IEA:Ensembl GO; GO:0021930; P:cerebellar granule cell precursor proliferation; IEA:Ensembl GO; GO:0021549; P:cerebellum development; IBA:GO_Central GO; GO:0021884; P:forebrain neuron development; IEA:Ensembl GO; GO:0030902; P:hindbrain development; IBA:GO_Central GO; GO:0042472; P:inner ear morphogenesis; IEA:Ensembl GO; GO:0021555; P:midbrain-hindbrain boundary morphogenesis; IEA:Ensembl GO; GO:0007399; P:nervous system development; TAS:ProtInc GO; GO:0001755; P:neural crest cell migration; IEA:Ensembl GO; GO:0051960; P:regulation of nervous system development; IBA:GO_Central GO; GO:0021568; P:rhombomere 2 development; IEA:Ensembl GO; GO:0021794; P:thalamus development; IEA:Ensembl CDD; cd00086; homeodomain; 1 InterPro; IPR031250; GBX-2 InterPro; IPR009057; Homeobox-like_sf InterPro; IPR017970; Homeobox_CS InterPro; IPR001356; Homeobox_dom InterPro; IPR020479; Homeobox_metazoa PANTHER; PTHR24334:SF3; PTHR24334:SF3; 1 Pfam; PF00046; Homeodomain; 1 PRINTS; PR00024; HOMEOBOX SMART; SM00389; HOX; 1 SUPFAM; SSF46689; SSF46689; 1 PROSITE; PS00027; HOMEOBOX_1; 1 PROSITE; PS50071; HOMEOBOX_2; 1 2: Evidence at transcript level; Complete proteome; DNA-binding; Homeobox; Nucleus; Reference proteome; Transcription; Transcription regulation CHAIN 1 348 Homeobox protein GBX-2 /FTId=PRO_0000048880 DNA_BIND 247 306 Homeobox. {ECO:0000255|PROSITE- ProRule:PRU00108} COMPBIAS 56 63 Poly-Pro COMPBIAS 121 124 Poly-Ala COMPBIAS 248 251 Poly-Arg CONFLICT 74 194 LPPAHPHHQIPSLPTGFCSSLAQGMALTSTLMATLPGGFSA SPQHQEAAAARKFAPQPLPGGGNFDKAEALQADAEDGKGFL AKEGSLLAFSAAETVQASLVGAVRGQGKDESKVEDDPKG -> CRPHTLTTRSPACPQASAPAWRRAWRSPLRSWPRSPAA SPRRPSTRRRQRPASSRRSRCPAAVTSTRRRRCRLTRRTAK ASWPKRARCSPSPRPRRCRLRSSGLSEGKGKTSQRWKTTRS (in Ref. 1; AAC03241). CONFLICT 216 237 QAAHKEEDPGHALEETPPSSGA -> PGSSQGGRPGPRGGG DPAEQRR (in Ref. 6). SEQUENCE 348 AA; 37348 MW; 5D31EA57B0CB07C0 CRC64; MSAAFPPSLM MMQRPLGSST AFSIDSLIGS PPQPSPGHFV YTGYPMFMPY RPVVLPPPPP PPPALPQAAL QPALPPAHPH HQIPSLPTGF CSSLAQGMAL TSTLMATLPG GFSASPQHQE AAAARKFAPQ PLPGGGNFDK AEALQADAED GKGFLAKEGS LLAFSAAETV QASLVGAVRG QGKDESKVED DPKGKEESFS LESDVDYSSD DNLTGQAAHK EEDPGHALEE TPPSSGAAGS TTSTGKNRRR RTAFTSEQLL ELEKEFHCKK YLSLTERSQI AHALKLSEVQ VKIWFQNRRA KWKRVKAGNA NSKTGEPSRN PKIVVPIPVH VSRFAIRSQH QQLEQARP
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abcepta antibody to, and receive a free "I Love Antibodies" mug.


GBX2 may act as a transcription factor for cell pluripotency and differentiation in the embryo.


Davila, S., et al. Genes Immun. 11(3):232-238(2010)
Heimbucher, T., et al. Mol. Cell. Biol. 27(1):340-351(2007)
Glinsky, G.V., et al. J. Clin. Invest. 115(6):1503-1521(2005)
Hillier, L.W., et al. Nature 434(7034):724-731(2005)
Gao, A.C., et al. Clin. Cancer Res. 6(2):493-497(2000)

Abcepta welcomes feedback from its customers.

If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at

$ 325.00
Cat# AM1997a
Availability: In Stock
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abcepta, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Terms & Conditions