EGF, rat recombinant protein
Urogastrone, URG, EGF, epidermal growth factor
- SPECIFICATION
- CITATIONS
- PROTOCOLS
- BACKGROUND
| Primary Accession | P07522 |
|---|---|
| Calculated MW | 6.151 kDa |
| Gene ID | Rn. 6075 |
|---|---|
| Gene Symbol | EGF |
| Other Names | Urogastrone, URG, EGF, epidermal growth factor |
| Gene Source | Rat |
| Source | E. coli |
| Assay&Purity | SDS-PAGE; ≥98% |
| Assay2&Purity2 | HPLC; ≥98% |
| Recombinant | Yes |
| Results | <0.1 ng/ml |
| Sequence | NSNTGCPPSYDGYCLNGGVCMYVESVDRYVCNCVIGYIGERCQHRDLRWWKLR |
| Target/Specificity | EGF |
| Application Notes | Centrifuge the vial prior to opening. Reconstitute in sterile H₂O to a concentration ≥ 100 µg/ml. This solution can then be diluted into other aqueous buffer. |
| Format | Lyophilized protein |
| Storage | -20°C; Lyophilized from PBS, pH 7.4 |

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
info@abcepta.com, and receive a free "I Love Antibodies" mug.
Provided below are standard protocols that you may find useful for product applications.
Background
Epidermal growth factor has a profound effect on the differentiation of specific cells in vivo and is a potent mitogenic factor for a variety of cultured cells of both ectodermal and mesodermal origin. The EGF precursor is believed to exist as a membrane-bound molecule which is proteolytically cleaved to generate the 53-amino acid peptide hormone that stimulates cells to divide. EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture. Epidermal Growth Factor Rat Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 53 amino acids and having a molecular mass of 6151 Dalton. The Rat EGF is purified by proprietary chromatographic techniques.
References
Price P.M.,et al.DNA Cell Biol. 11:481-487(1992).
Price P.M.,et al.Submitted (JAN-1994) to the EMBL/GenBank/DDBJ databases.
Simpson R.J.,et al.Eur. J. Biochem. 153:629-637(1985).
Dorow D.S.,et al.Nucleic Acids Res. 16:9338-9338(1988).
If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.
If you have any additional inquiries please email technical services at tech@abcepta.com.





Foundational characteristics of cancer include proliferation, angiogenesis, migration, evasion of apoptosis, and cellular immortality. Find key markers for these cellular processes and antibodies to detect them.
The SUMOplot™ Analysis Program predicts and scores sumoylation sites in your protein. SUMOylation is a post-translational modification involved in various cellular processes, such as nuclear-cytosolic transport, transcriptional regulation, apoptosis, protein stability, response to stress, and progression through the cell cycle.
The Autophagy Receptor Motif Plotter predicts and scores autophagy receptor binding sites in your protein. Identifying proteins connected to this pathway is critical to understanding the role of autophagy in physiological as well as pathological processes such as development, differentiation, neurodegenerative diseases, stress, infection, and cancer.

