Foundational characteristics of cancer include proliferation, angiogenesis, migration, evasion of apoptosis, and cellular immortality. Find key markers for these cellular processes and antibodies to detect them.
The SUMOplot™ Analysis Program predicts and scores sumoylation sites in your protein. SUMOylation is a post-translational modification involved in various cellular processes, such as nuclear-cytosolic transport, transcriptional regulation, apoptosis, protein stability, response to stress, and progression through the cell cycle.
The Autophagy Receptor Motif Plotter predicts and scores autophagy receptor binding sites in your protein. Identifying proteins connected to this pathway is critical to understanding the role of autophagy in physiological as well as pathological processes such as development, differentiation, neurodegenerative diseases, stress, infection, and cancer.
IL-17A/F, human recombinant protein
IL17A/F, IL17 A/F, IL-17A/F Interleukin-17 A/F, Interleukin-17 AF
- SPECIFICATION
- CITATIONS
- PROTOCOLS
- BACKGROUND
| Primary Accession | Q96PD4 |
|---|---|
| Calculated MW | 30.7 kDa |
| Gene ID | IL17A-3605 IL17F-112744 |
|---|---|
| Gene Symbol | IL17A;IL17F |
| Other Names | IL17A/F, IL17 A/F, IL-17A/F Interleukin-17 A/F, Interleukin-17 AF, Cytotoxic T-lymphocyte-associated antigen 8 |
| Gene Source | Human |
| Source | E. coli |
| Assay&Purity | SDS-PAGE; ≥98% |
| Assay2&Purity2 | HPLC; |
| Recombinant | Yes |
| Sequence | MIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVAMRKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHHVQ |
| Target/Specificity | IL-17A/F |
| Application Notes | Centrifuge the vial prior to opening. Reconstitute with sterile H₂O to a concentration not more than 1 mg/ml; This solution can then be diluted into other aqueous buffers. |
| Format | Lyophilized protein |
| Storage | -20°C; Lyophilized with no additives |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
info@abcepta.com, and receive a free "I Love Antibodies" mug.
Provided below are standard protocols that you may find useful for product applications.
Background
Human IL-17A/F is a 40 kDa glycoprotein which is secreted as a disulfide-linked heterodimer. IL-17A/F consists of two proteins, IL-17A and IL17F. Human IL17A is produced as a 155 a.a precursor that includes a 23 amino acids signal sequence and a 132 amino acid chain that includes an N-linked glycosylation site. Human IL17F is produced as a 153 amino acid precursor with a 20 amino acid signal sequence and a 133 amino acid region and an N-linked glycosylation site. Both proteins (IL17A & IL17F) share 50 % amino acid sequence identity. Human IL17A & IL17F show approximately 60 % homology in their amino acid sequence to mouse IL-17A and IL-17F. Interleukin-17A/F and IL17A, IL17F homodimers are manufactured by activted CD4+ T cells, called Th17. IL-23 causes Th17 lymphocytes to manufacture IL-17A/F. Interleukin-17A/F induces chemokine production and airway neutrophilia with intermediate potency between IL17A (most potent) and IL17F (least potent). IL-17A/F Human Recombinant produced in E.Coli is a heterodimeric, non-glycosylated polypeptide chain containing 1 monomeric subunit of each IL-17A & IL-17F. The active dimer contains 271 amino acids and having a total molecular mass of 30.7 kDa. The IL-17A/F Human is purified by proprietary chromatographic techniques.
References
Starnes T.,et al.J. Immunol. 167:4137-4140(2001).
Mungall A.J.,et al.Nature 425:805-811(2003).
Kawaguchi M.,et al.J. Immunol. 167:4430-4435(2001).
Zhang Z.,et al.Protein Sci. 13:2819-2824(2004).
Hymowitz S.G.,et al.EMBO J. 20:5332-5341(2001).
If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.
If you have any additional inquiries please email technical services at tech@abcepta.com.
Ordering Information
Other Products
Shipping Information
