Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Primary Antibodies   >   Neuroscience   >   KCNRG Antibody (C-term)   

KCNRG Antibody (C-term)

Peptide Affinity Purified Rabbit Polyclonal Antibody (Pab)

     
  • IHC-P - KCNRG Antibody (C-term) AP11851b
    KCNRG Antibody (C-term) (Cat. #AP11851b)immunohistochemistry analysis in formalin fixed and paraffin embedded human brain tissue followed by peroxidase conjugation of the secondary antibody and DAB staining.This data demonstrates the use of KCNRG Antibody (C-term) for immunohistochemistry. Clinical relevance has not been evaluated.
  • WB - KCNRG Antibody (C-term) AP11851b
    KCNRG Antibody (C-term) (Cat. #AP11851b) western blot analysis in mouse liver,lung tissue lysates (35ug/lane).This demonstrates the KCNRG antibody detected the KCNRG protein (arrow).
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
Product Information
Application
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • E=ELISA
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
WB, IHC-P, E
Primary Accession Q8N5I3
Other Accession NP_005789.2, NP_001007279.1, NP_775876.1
Reactivity Mouse
Host Rabbit
Clonality Polyclonal
Isotype Rabbit Ig
Antigen Region 175-202 aa
Additional Information
Other Names Potassium channel regulatory protein, Potassium channel regulator, Protein CLLD4, KCNRG, CLLD4
Target/Specificity This KCNRG antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 175-202 amino acids from the C-terminal region of human KCNRG.
Dilution IHC-P~~1:10~50
WB~~1:1000
Format Purified polyclonal antibody supplied in PBS with 0.09% (W/V) sodium azide. This antibody is purified through a protein A column, followed by peptide affinity purification.
StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
PrecautionsKCNRG Antibody (C-term) is for research use only and not for use in diagnostic or therapeutic procedures.
Protein Information
Name KCNRG
Synonyms CLLD4
Function Inhibits potassium fluxes in cells. May regulate Kv1 family channel proteins by retaining a fraction of channels in endomembranes.
Cellular Location Endoplasmic reticulum
Tissue Location Ubiquitous in normal tissues and expressed in some tumor tissues. EMBL; AY129653; AAN06090.1; -; mRNA EMBL; AY129654; AAN06091.1; -; mRNA EMBL; AY169387; AAO11777.1; -; mRNA EMBL; AY169388; AAO11778.1; -; mRNA EMBL; AY190921; AAO27464.1; -; mRNA EMBL; AY190922; AAO27465.1; -; mRNA EMBL; AL137060; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; CH471075; EAX08849.1; -; Genomic_DNA EMBL; CH471075; EAX08850.1; -; Genomic_DNA EMBL; BC020887; AAH20887.1; -; mRNA EMBL; BC032343; AAH32343.1; -; mRNA CCDS; CCDS41889.1; -. [Q8N5I3-2] CCDS; CCDS9424.1; -. [Q8N5I3-1] RefSeq; NP_775876.1; NM_173605.1. [Q8N5I3-1] RefSeq; NP_955751.1; NM_199464.2. [Q8N5I3-2] UniGene; Hs.660161; - ProteinModelPortal; Q8N5I3; - SMR; Q8N5I3; - BioGrid; 129592; 8 IntAct; Q8N5I3; 9 MINT; Q8N5I3; - STRING; 9606.ENSP00000324191; - iPTMnet; Q8N5I3; - PhosphoSitePlus; Q8N5I3; - BioMuta; KCNRG; - DMDM; 74729005; - PaxDb; Q8N5I3; - PeptideAtlas; Q8N5I3; - PRIDE; Q8N5I3; - ProteomicsDB; 72060; - ProteomicsDB; 72061; -. [Q8N5I3-2] DNASU; 10206; - DNASU; 283518; - Ensembl; ENST00000312942; ENSP00000324191; ENSG00000198553. [Q8N5I3-1] Ensembl; ENST00000360473; ENSP00000353661; ENSG00000198553. [Q8N5I3-2] GeneID; 283518; - KEGG; hsa:283518; - UCSC; uc001vdt.4; human. [Q8N5I3-1] CTD; 283518; - DisGeNET; 283518; - EuPathDB; HostDB:ENSG00000198553.8; - GeneCards; KCNRG; - HGNC; HGNC:18893; KCNRG HPA; HPA001027; - MIM; 607947; gene neXtProt; NX_Q8N5I3; - OpenTargets; ENSG00000198553; - PharmGKB; PA134924183; - eggNOG; KOG2723; Eukaryota eggNOG; ENOG410Z155; LUCA GeneTree; ENSGT00940000161898; - HOGENOM; HOG000230898; - HOVERGEN; HBG079982; - InParanoid; Q8N5I3; - OMA; DTLLMEG; - OrthoDB; 635534at2759; - PhylomeDB; Q8N5I3; - TreeFam; TF315332; - GeneWiki; KCNRG; - GenomeRNAi; 283518; - PRO; PR:Q8N5I3; - Proteomes; UP000005640; Chromosome 13 Bgee; ENSG00000198553; Expressed in 87 organ(s), highest expression level in right uterine tube Genevisible; Q8N5I3; HS GO; GO:0005783; C:endoplasmic reticulum; IDA:UniProtKB GO; GO:0042802; F:identical protein binding; IPI:IntAct GO; GO:1902260; P:negative regulation of delayed rectifier potassium channel activity; IDA:UniProtKB GO; GO:0051260; P:protein homooligomerization; IEA:InterPro InterPro; IPR000210; BTB/POZ_dom InterPro; IPR011333; SKP1/BTB/POZ_sf InterPro; IPR003131; T1-type_BTB Pfam; PF02214; BTB_2; 1 SMART; SM00225; BTB; 1 SUPFAM; SSF54695; SSF54695; 1 1: Evidence at protein level; Alternative splicing; Complete proteome; Endoplasmic reticulum; Reference proteome CHAIN 1 272 Potassium channel regulatory protein /FTId=PRO_0000238945 DOMAIN 5 106 BTB VAR_SEQ 194 229 YVSIKPDNRKLANGTNVLGLLIDTLLKEGFHLVSTR -> L VCNGVISAHHNLRLWGSSDSPASASRVAGITGMFL (in isoform 2). {ECO:0000303|PubMed:12650944, ECO:0000303|PubMed:15489334, ECO:0000303|Ref.2} /FTId=VSP_019018 VAR_SEQ 230 272 Missing (in isoform 2) {ECO:0000303|PubMed:12650944, ECO:0000303|PubMed:15489334, ECO:0000303|Ref.2} /FTId=VSP_019021 SEQUENCE 272 AA; 31048 MW; 5018F55980F0BBA5 CRC64; MSSQELVTLN VGGKIFTTRF STIKQFPASR LARMLDGRDQ EFKMVGGQIF VDRDGDLFSF ILDFLRTHQL LLPTEFSDYL RLQREALFYE LRSLVDLLNP YLLQPRPALV EVHFLSRNTQ AFFRVFGSCS KTIEMLTGRI TVFTEQPSAP TWNGNFFPPQ MTLLPLPPQR PSYHDLVFQC GSDSTTDNQT GVRYVSIKPD NRKLANGTNV LGLLIDTLLK EGFHLVSTRT VSSEDKTECY SFERIKSPEV LITNETPKPE TIIIPEQSQI KK
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abcepta antibody to
info@abcepta.com, and receive a free "I Love Antibodies" mug.

Background

This gene encodes a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This gene is located on chromosome 13 within the minimal deletion region for B-cell chronic lymphocytic leukemia. Multiple alternatively spliced transcript variants have been found for this gene.

References

Lerner, M., et al. Mol. Biol. Cell 18(5):1670-1682(2007)
Skoblov, M., et al. Biochem. Biophys. Res. Commun. 342(3):859-866(2006)
Corcoran, M.M., et al. Genes Chromosomes Cancer 40(4):285-297(2004)
Dunham, A., et al. Nature 428(6982):522-528(2004)
van Everdink, W.J., et al. Cancer Genet. Cytogenet. 146(1):48-57(2003)

FeedBack
Abcepta welcomes feedback from its customers.

If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abcepta.com.

$ 325.00
$ 109.00
Cat# AP11851b
Size:
Quantity:
Availability: In Stock
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abcepta, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Terms & Conditions
"