Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Primary Antibodies   >   Cell Biology   >   LIMS3/LIMS3L Antibody (Center)   

LIMS3/LIMS3L Antibody (Center)

Peptide Affinity Purified Rabbit Polyclonal Antibody (Pab)

     
  • WB - LIMS3/LIMS3L Antibody (Center) AP18789C
    LIMS3/LIMS3L Antibody (Center)(Cat. #AP18789c) western blot analysis in 293 cell line lysates (35ug/lane).This demonstrates the LIMS3/LIMS3L antibody detected the LIMS3/LIMS3L protein (arrow).
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
Product Information
Application
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • E=ELISA
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
WB, E
Primary Accession P0CW19
Other Accession P0CW20, NP_001192217.1
Reactivity Human
Host Rabbit
Clonality Polyclonal
Isotype Rabbit Ig
Antigen Region 28-54 aa
Additional Information
Other Names LIM and senescent cell antigen-like-containing domain protein 3, Particularly interesting new Cys-His protein 3, PINCH-3, LIMS3, PINCH3
Target/Specificity This LIMS3/LIMS3L antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 28-54 amino acids from the Central region of human LIMS3/LIMS3L.
Dilution WB~~1:1000
Format Purified polyclonal antibody supplied in PBS with 0.09% (W/V) sodium azide. This antibody is purified through a protein A column, followed by peptide affinity purification.
StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
PrecautionsLIMS3/LIMS3L Antibody (Center) is for research use only and not for use in diagnostic or therapeutic procedures.
Protein Information
Name LIMS3
Synonyms PINCH3
Cellular Location Cytoplasm.
Tissue Location Detected in testis. {ECO:0000269|Ref.1}. EMBL; AF288404; AAF99328.1; -; mRNA EMBL; AK298340; BAG60588.1; -; mRNA EMBL; AK316210; BAH14581.1; -; mRNA EMBL; AC013271; AAY14903.1; -; Genomic_DNA EMBL; AC108938; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; AC112229; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; BC093812; AAH93812.1; -; mRNA EMBL; BC112233; AAI12234.1; -; mRNA CCDS; CCDS2084.1; -. [P0CW19-1] RefSeq; NP_001192217.1; NM_001205288.1. [P0CW19-1] RefSeq; NP_277049.1; NM_033514.4. [P0CW19-1] UniGene; Hs.535619; - UniGene; Hs.735995; - ProteinModelPortal; P0CW19; - SMR; P0CW19; - BioGrid; 125178; 2 IntAct; P0CW19; 10 STRING; 9606.ENSP00000457330; - iPTMnet; P0CW19; - PhosphoSitePlus; P0CW19; - BioMuta; LIMS3; - DMDM; 334350997; - jPOST; P0CW19; - PaxDb; P0CW19; - PeptideAtlas; P0CW19; - PRIDE; P0CW19; - ProteomicsDB; 52518; - DNASU; 96626; - Ensembl; ENST00000437679; ENSP00000405165; ENSG00000256977. [P0CW19-1] Ensembl; ENST00000631420; ENSP00000488227; ENSG00000256977. [P0CW19-2] GeneID; 100288695; - GeneID; 96626; - KEGG; hsa:100288695; - KEGG; hsa:96626; - CTD; 100288695; - CTD; 96626; - DisGeNET; 100288695; - DisGeNET; 96626; - EuPathDB; HostDB:ENSG00000256977.10; - EuPathDB; HostDB:ENSG00000257207.5; - GeneCards; LIMS3; - HGNC; HGNC:30047; LIMS3 HPA; HPA058455; - neXtProt; NX_P0CW19; - OpenTargets; ENSG00000257207; - PharmGKB; PA134917873; - eggNOG; ENOG410JC6F; Eukaryota eggNOG; KOG2272; Eukaryota eggNOG; ENOG410XP46; LUCA eggNOG; ENOG41119KQ; LUCA GeneTree; ENSGT00940000153518; - HOGENOM; HOG000015300; - HOVERGEN; HBG081915; - InParanoid; P0CW19; - OrthoDB; 292981at2759; - TreeFam; TF314113; - PRO; PR:P0CW19; - Proteomes; UP000005640; Chromosome 2 Bgee; ENSG00000256977; Expressed in 86 organ(s), highest expression level in thoracic aorta ExpressionAtlas; P0CW19; baseline Genevisible; P0CW19; HS GO; GO:0005737; C:cytoplasm; IEA:UniProtKB-SubCell GO; GO:0046872; F:metal ion binding; IEA:UniProtKB-KW InterPro; IPR017351; PINCH InterPro; IPR001781; Znf_LIM PANTHER; PTHR24210; PTHR24210; 1 Pfam; PF00412; LIM; 1 SMART; SM00132; LIM; 1 PROSITE; PS00478; LIM_DOMAIN_1; 1 PROSITE; PS50023; LIM_DOMAIN_2; 1 2: Evidence at transcript level; Alternative splicing; Complete proteome; Cytoplasm; LIM domain; Metal-binding; Reference proteome; Zinc CHAIN 1 117 LIM and senescent cell antigen-like- containing domain protein 3 /FTId=PRO_0000266013 DOMAIN 70 117 LIM zinc-binding. {ECO:0000255|PROSITE- ProRule:PRU00125} VAR_SEQ 115 117 ERT -> FEGRKYCEHDFQMLFAPCCHQCGEFIIGRVIKAM NNSWHPECFRCDLCQEVLADIGFVKNAGRHLCRPCHNREKA RGLGKYICQKCHAIIDEQPLIFKNDPYHPDHFNCANCGQEG SDCRCTGAERGAILPAMP (in isoform 2) /FTId=VSP_054392 SEQUENCE 117 AA; 13251 MW; F260926C06DA51CE CRC64; MAFSGRARPC IIPENEEIPR AALNTVHEAN GTEDERAVSK LQRRHSDVKV YKEFCDFYAK FNMANALASA TCERCKGGFA PAETIVNSNG ELYHEQCFVC AQCFQQFPEG LFYEERT
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abcepta antibody to
info@abcepta.com, and receive a free "I Love Antibodies" mug.

Background

The function of this protein remains unknown.

FeedBack
Abcepta welcomes feedback from its customers.

If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abcepta.com.

$ 325.00
$ 109.00
Cat# AP18789C
Size:
Quantity:
Availability: In Stock
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abcepta, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Terms & Conditions
"