Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
COVID19
>   home   >   Products   >   Primary Antibodies   >   Cancer   >   Anti-HDGF Picoband Antibody   

Anti-HDGF Picoband Antibody

     
  • WB - Anti-HDGF Picoband Antibody ABO10143
    Western blot analysis of HDGF expression in rat liver extract (lane 1) and 22RV1 whole cell lysates (lane 2). HDGF at 37KD was detected using rabbit anti- HDGF Antigen Affinity purified polyclonal antibody (Catalog # ABO10143) at 0.5 μg/mL. The blot was developed using chemiluminescence (ECL) method .
    detail
  • IHC - Anti-HDGF Picoband Antibody ABO10143
    HDGF was detected in paraffin-embedded sections of mouse liver tissues using rabbit anti- HDGF Antigen Affinity purified polyclonal antibody (Catalog # ABO10143) at 1 μg/mL. The immunohistochemical section was developed using SABC method .
    detail
  • IHC - Anti-HDGF Picoband Antibody ABO10143
    HDGF was detected in paraffin-embedded sections of rat liver tissues using rabbit anti- HDGF Antigen Affinity purified polyclonal antibody (Catalog # ABO10143) at 1 μg/mL. The immunohistochemical section was developed using SABC method .
    detail
  • IHC - Anti-HDGF Picoband Antibody ABO10143
    HDGF was detected in paraffin-embedded sections of human intestinal cancer tissues using rabbit anti- HDGF Antigen Affinity purified polyclonal antibody (Catalog # ABO10143) at 1 μg/mL. The immunohistochemical section was developed using SABC method .
    detail
  • IHC - Anti-HDGF Picoband Antibody ABO10143
    HDGF was detected in paraffin-embedded sections of human lung cancer tissues using rabbit anti- HDGF Antigen Affinity purified polyclonal antibody (Catalog # ABO10143) at 1 μg/mL. The immunohistochemical section was developed using SABC method .
    detail
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
  • detail
Product Information
Application
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • E=ELISA
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immuno electron microscopy
  • EIA=Enzyme Immunoassay
WB, IHC-P
Primary Accession P51858
Host Rabbit
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Format Lyophilized
Description Rabbit IgG polyclonal antibody for Hepatoma-derived growth factor(HDGF) detection. Tested with WB, IHC-P in Human;Mouse;Rat.
Reconstitution Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Additional Information
Gene ID 3068
Other Names Hepatoma-derived growth factor, HDGF, High mobility group protein 1-like 2, HMG-1L2, HDGF, HMG1L2
Calculated MW 26788 MW KDa
Application Details Immunohistochemistry(Paraffin-embedded Section), 0.5-1 µg/ml, Human, Mouse, Rat, By Heat

Western blot, 0.1-0.5 µg/ml, Human, Rat
Subcellular Localization Cytoplasm. Nucleus.
Tissue Specificity Ubiquitous.
Protein Name Hepatoma-derived growth factor
Contents Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human HDGF (61-97aa KDLFPYEESKEKFGKPNKRKGFSEGLWEIENNPTVKA), identical to the related mouse and rat sequences.
Purification Immunogen affinity purified.
Cross Reactivity No cross reactivity with other proteins
Storage At -20˚C for one year. After r˚Constitution, at 4˚C for one month. It˚Can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Information
Name HDGF
Synonyms HMG1L2
Function [Isoform 1]: Acts as a transcriptional repressor (PubMed:17974029). Has mitogenic activity for fibroblasts (PubMed:11751870, PubMed:26845719). Heparin-binding protein (PubMed:15491618).
Cellular Location [Isoform 1]: Nucleus. Cytoplasm. Secreted, extracellular exosome. Note=Secreted by exosomes and is located inside the exosome (PubMed:27926477). May also be secreted as free protein via an as yet unknown pathway (PubMed:27926477) [Isoform 3]: Nucleus. Cytoplasm Secreted, extracellular exosome Note=Secreted by exosomes and is located on the outer exosome surface
Tissue Location Ubiquitous..
Research Areas
Citations (0)
citation

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abcepta antibody to
info@abcepta.com, and receive a free "I Love Antibodies" mug.

Background

Hepatoma-derived growth factor (HDGF), also known as high mobility group protein 1-like 2 (HMG-1L2), is a protein that in humans is encoded by the HDGF gene. This gene encodes a member of the hepatoma-derived growth factor family. The encoded protein has mitogenic and DNA-binding activity and may play a role in cellular proliferation and differentiation. High levels of expression of this gene enhance the growth of many tumors. And this gene was thought initially to be located on chromosome X; however, that location has been determined to correspond to a related pseudogene. Alternatively spliced transcript variants encoding distinct isoforms have been described.

FeedBack
Abcepta welcomes feedback from its customers.

If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abcepta.com.

$ 370.00
Cat# ABO10143
Size:
Quantity:
Availability: 3-5 days
Bulk Size

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaMexicoNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abcepta, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Terms & Conditions
"