Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
COVID19
>   home   >   Products   >   Primary Antibodies   >   Antibody Collections   >   Mitochondrion   >   Anti-Periplakin Picoband Antibody   

Anti-Periplakin Picoband Antibody

     
  • WB - Anti-Periplakin Picoband Antibody ABO10228
    Western blot analysis of Periplakin expression in rat stomach extract (lane 1) and HELA whole cell lysates (lane 2). Periplakin at 202KD was detected using rabbit anti- Periplakin Antigen Affinity purified polyclonal antibody (Catalog #ABO10228) at 0.5 μg/mL. The blot was developed using chemiluminescence (ECL) method .
    detail
  • IHC - Anti-Periplakin Picoband Antibody ABO10228
    Periplakin was detected in paraffin-embedded sections of mouse lung tissues using rabbit anti- Periplakin Antigen Affinity purified polyclonal antibody (Catalog # ABO10228) at 1 μg/mL. The immunohistochemical section was developed using SABC method .
    detail
  • IHC - Anti-Periplakin Picoband Antibody ABO10228
    Periplakin was detected in paraffin-embedded sections of rat lung tissues using rabbit anti- Periplakin Antigen Affinity purified polyclonal antibody (Catalog # ABO10228) at 1 μg/mL. The immunohistochemical section was developed using SABC method .
    detail
  • IHC - Anti-Periplakin Picoband Antibody ABO10228
    Periplakin was detected in paraffin-embedded sections of rat skin tissues using rabbit anti- Periplakin Antigen Affinity purified polyclonal antibody (Catalog # ABO10228) at 1 μg/mL. The immunohistochemical section was developed using SABC method .
    detail
  • IHC - Anti-Periplakin Picoband Antibody ABO10228
    Periplakin was detected in paraffin-embedded sections of human tonsil tissues using rabbit anti- Periplakin Antigen Affinity purified polyclonal antibody (Catalog # ABO10228) at 1 μg/mL. The immunohistochemical section was developed using SABC method .
    detail
  • IHC - Anti-Periplakin Picoband Antibody ABO10228
    Periplakin was detected in paraffin-embedded sections of human lung cancer tissues using rabbit anti- Periplakin Antigen Affinity purified polyclonal antibody (Catalog # ABO10228) at 1 μg/mL. The immunohistochemical section was developed using SABC method .
    detail
  • IHC - Anti-Periplakin Picoband Antibody ABO10228
    Periplakin was detected in paraffin-embedded sections of human oesophagus squama cancer tissues using rabbit anti- Periplakin Antigen Affinity purified polyclonal antibody (Catalog # ABO10228) at 1 μg/mL. The immunohistochemical section was developed using SABC method .
    detail
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
  • detail
Product Information
Application
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • E=ELISA
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immuno electron microscopy
  • EIA=Enzyme Immunoassay
WB, IHC-P
Primary Accession O60437
Host Rabbit
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Format Lyophilized
Description Rabbit IgG polyclonal antibody for Periplakin(PPL) detection. Tested with WB, IHC-P in Human;Mouse;Rat.
Reconstitution Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Additional Information
Gene ID 5493
Other Names Periplakin, 190 kDa paraneoplastic pemphigus antigen, 195 kDa cornified envelope precursor protein, PPL, KIAA0568
Calculated MW 204747 MW KDa
Application Details Immunohistochemistry(Paraffin-embedded Section), 0.5-1 µg/ml, Human, Mouse, Rat, By Heat

Western blot, 0.1-0.5 µg/ml, Human, Rat
Subcellular Localization Cell junction, desmosome . Cytoplasm, cytoskeleton . Cell membrane . Nucleus . Mitochondrion . Associated with desmosomes and intermediate filaments.
Tissue Specificity Expressed in stratified squamous epithelia and in some other epithelia. .
Protein Name Periplakin
Contents Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human Periplakin (1664-1701aa DTGRELSPEEAHRAGLIDWNMFVKLRSQECDWEEISVK), different from the related mouse sequence by one amino acid.
Purification Immunogen affinity purified.
Cross Reactivity No cross reactivity with other proteins
Storage At -20˚C for one year. After r˚Constitution, at 4˚C for one month. It˚Can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Information
Name PPL
Synonyms KIAA0568
Function Component of the cornified envelope of keratinocytes. May link the cornified envelope to desmosomes and intermediate filaments. May act as a localization signal in PKB/AKT-mediated signaling.
Cellular Location Cell junction, desmosome. Cytoplasm, cytoskeleton. Cell membrane {ECO:0000250|UniProtKB:Q9R269}. Cytoplasm {ECO:0000250|UniProtKB:Q9R269}
Tissue Location Expressed in stratified squamous epithelia and in some other epithelia.
Research Areas
Citations (0)
citation

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abcepta antibody to
info@abcepta.com, and receive a free "I Love Antibodies" mug.

Background

Periplakin is a protein that in humans is encoded by the PPL gene. The protein encoded by this gene is a component of desmosomes and of the epidermal cornified envelope in keratinocytes. The N-terminal domain of this protein interacts with the plasma membrane and its C-terminus interacts with intermediate filaments. Through its rod domain, this protein forms complexes with envoplakin. This protein may serve as a link between the cornified envelope and desmosomes as well as intermediate filaments. AKT1/PKB, a protein kinase mediating a variety of cell growth and survival signaling processes, is reported to interact with this protein, suggesting a possible role for this protein as a localization signal in AKT1-mediated signaling.

FeedBack
Abcepta welcomes feedback from its customers.

If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abcepta.com.

$ 370.00
Cat# ABO10228
Size:
Quantity:
Availability: 3-5 days
Bulk Size

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthersMexico
Abcepta, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Terms & Conditions
"