Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
COVID19
>   home   >   Products   >   Primary Antibodies   >   Antibody Collections   >   Apoptosis   >   Anti-DR4 Picoband Antibody   

Anti-DR4 Picoband Antibody

     
  • WB - Anti-DR4 Picoband Antibody ABO10230
    Western blot analysis of DR4 expression in rat spleen extract (lane 1), mouse spleen extract (lane 2) and MCF-7 whole cell lysates (lane 3). DR4 at 50KD was detected using rabbit anti- DR4 Antigen Affinity purified polyclonal antibody (Catalog # ABO10230) at 0.5 μg/mL. The blot was developed using chemiluminescence (ECL) method .
    detail
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
  • detail
Product Information
Application
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • E=ELISA
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immuno electron microscopy
  • EIA=Enzyme Immunoassay
WB, IHC-F, FC, ICC
Primary Accession O00220
Host Rabbit
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Format Lyophilized
Description Rabbit IgG polyclonal antibody for Tumor necrosis factor receptor superfamily member 10A(TNFRSF10A) detection. Tested with WB, IHC-F, ICC, FCM in Human;Mouse;Rat.
Reconstitution Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Additional Information
Gene ID 8797
Other Names Tumor necrosis factor receptor superfamily member 10A, Death receptor 4, TNF-related apoptosis-inducing ligand receptor 1, TRAIL receptor 1, TRAIL-R1, CD261, TNFRSF10A, APO2, DR4, TRAILR1
Calculated MW 50089 MW KDa
Application Details Immunohistochemistry(Frozen Section), 0.5-1 µg/ml

Immunocytochemistry, 0.5-1 µg/ml
Western blot, 0.1-0.5 µg/ml
Flow Cytometry, 1-3μg/1x106cells
Subcellular Localization Membrane; Single-pass type I membrane protein.
Tissue Specificity Widely expressed. High levels are found in spleen, peripheral blood leukocytes, small intestine and thymus, but also in K-562 erythroleukemia cells, MCF-7 breast carcinoma cells and activated T-cells.
Protein Name Tumor necrosis factor receptor superfamily member 10A
Contents Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human DR4 (99-131aa VLLQVVPSSAATIKLHDQSIGTQQWEHSPLGEL).
Purification Immunogen affinity purified.
Cross Reactivity No cross reactivity with other proteins.
Storage At -20˚C for one year. After r˚Constitution, at 4˚C for one month. It˚Can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Information
Name TNFRSF10A
Synonyms APO2, DR4, TRAILR1
Function Receptor for the cytotoxic ligand TNFSF10/TRAIL (PubMed:26457518, PubMed:38532423). The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis (PubMed:19090789). Promotes the activation of NF-kappa-B (PubMed:9430227).
Cellular Location Cell membrane; Single-pass type I membrane protein. Membrane raft. Cytoplasm, cytosol. Note=Palmitoylation is required for association with membranes.
Tissue Location Widely expressed. High levels are found in spleen, peripheral blood leukocytes, small intestine and thymus, but also in K- 562 erythroleukemia cells, MCF-7 breast carcinoma cells and activated T-cells
Research Areas
Citations (0)
citation

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abcepta antibody to
info@abcepta.com, and receive a free "I Love Antibodies" mug.

Background

TNFRSF10A (Tumor Necrosis Factor Receptor Subfamily Member 10A), also known as APO2, DR4 or TRAILR1, is a protein that in humans is encoded by the TNFRSF10A gene. The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is activated by tumor necrosis factor-related apoptosis inducing ligand (TNFSF10/TRAIL), and thus transduces cell death signal and induces cell apoptosis. Studies with FADD-deficient mice suggested that FADD, a death domain containing adaptor protein, is required for the apoptosis mediated by this protein.

FeedBack
Abcepta welcomes feedback from its customers.

If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abcepta.com.

$ 370.00
Cat# ABO10230
Size:
Quantity:
Availability: 3-5 days
Bulk Size

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaMexicoNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abcepta, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Terms & Conditions
"