Anti-DR4 Picoband Antibody
- SPECIFICATION
- CITATIONS
- PROTOCOLS
- BACKGROUND
Application
| WB, IHC-F, FC, ICC |
---|---|
Primary Accession | O00220 |
Host | Rabbit |
Reactivity | Human, Mouse, Rat |
Clonality | Polyclonal |
Format | Lyophilized |
Description | Rabbit IgG polyclonal antibody for Tumor necrosis factor receptor superfamily member 10A(TNFRSF10A) detection. Tested with WB, IHC-F, ICC, FCM in Human;Mouse;Rat. |
Reconstitution | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Gene ID | 8797 |
---|---|
Other Names | Tumor necrosis factor receptor superfamily member 10A, Death receptor 4, TNF-related apoptosis-inducing ligand receptor 1, TRAIL receptor 1, TRAIL-R1, CD261, TNFRSF10A, APO2, DR4, TRAILR1 |
Calculated MW | 50089 MW KDa |
Application Details | Immunohistochemistry(Frozen Section), 0.5-1 µg/ml Immunocytochemistry, 0.5-1 µg/ml Western blot, 0.1-0.5 µg/ml Flow Cytometry, 1-3μg/1x106cells |
Subcellular Localization | Membrane; Single-pass type I membrane protein. |
Tissue Specificity | Widely expressed. High levels are found in spleen, peripheral blood leukocytes, small intestine and thymus, but also in K-562 erythroleukemia cells, MCF-7 breast carcinoma cells and activated T-cells. |
Protein Name | Tumor necrosis factor receptor superfamily member 10A |
Contents | Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3. |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human DR4 (99-131aa VLLQVVPSSAATIKLHDQSIGTQQWEHSPLGEL). |
Purification | Immunogen affinity purified. |
Cross Reactivity | No cross reactivity with other proteins. |
Storage | At -20˚C for one year. After r˚Constitution, at 4˚C for one month. It˚Can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing. |
Name | TNFRSF10A |
---|---|
Synonyms | APO2, DR4, TRAILR1 |
Function | Receptor for the cytotoxic ligand TNFSF10/TRAIL (PubMed:26457518). The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis (PubMed:19090789). Promotes the activation of NF- kappa-B (PubMed:9430227). |
Cellular Location | Cell membrane; Single-pass type I membrane protein. Membrane raft. Cytoplasm, cytosol. Note=Palmitoylation is required for association with membranes. |
Tissue Location | Widely expressed. High levels are found in spleen, peripheral blood leukocytes, small intestine and thymus, but also in K- 562 erythroleukemia cells, MCF-7 breast carcinoma cells and activated T-cells |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
info@abcepta.com, and receive a free "I Love Antibodies" mug.
Provided below are standard protocols that you may find useful for product applications.
Background
TNFRSF10A (Tumor Necrosis Factor Receptor Subfamily Member 10A), also known as APO2, DR4 or TRAILR1, is a protein that in humans is encoded by the TNFRSF10A gene. The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is activated by tumor necrosis factor-related apoptosis inducing ligand (TNFSF10/TRAIL), and thus transduces cell death signal and induces cell apoptosis. Studies with FADD-deficient mice suggested that FADD, a death domain containing adaptor protein, is required for the apoptosis mediated by this protein.
If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.
If you have any additional inquiries please email technical services at tech@abcepta.com.