Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
COVID19
>   home   >   Products   >   Primary Antibodies   >   Neuroscience   >   Anti-CHRNA5 Picoband Antibody   

Anti-CHRNA5 Picoband Antibody

     
  • WB - Anti-CHRNA5 Picoband Antibody ABO10244
    Western blot analysis of CHRNA5 expression in rat skeletal muscle extract (lane 1) and HEPG2 whole cell lysates (lane 2). CHRNA5 at 53KD was detected using rabbit anti- CHRNA5 Antigen Affinity purified polyclonal antibody (Catalog #ABO10244) at 0.5 μg/mL. The blot was developed using chemiluminescence (ECL) method .
    detail
  • IHC - Anti-CHRNA5 Picoband Antibody ABO10244
    CHRNA5 was detected in paraffin-embedded sections of mouse intestine tissues using rabbit anti- CHRNA5 Antigen Affinity purified polyclonal antibody (Catalog # ABO10244) at 1 μg/mL. The immunohistochemical section was developed using SABC method .
    detail
  • IHC - Anti-CHRNA5 Picoband Antibody ABO10244
    CHRNA5 was detected in paraffin-embedded sections of mouse cardiac muscle tissues using rabbit anti- CHRNA5 Antigen Affinity purified polyclonal antibody (Catalog # ABO10244) at 1 μg/mL. The immunohistochemical section was developed using SABC method .
    detail
  • IHC - Anti-CHRNA5 Picoband Antibody ABO10244
    CHRNA5 was detected in paraffin-embedded sections of rat intestine tissues using rabbit anti- CHRNA5 Antigen Affinity purified polyclonal antibody (Catalog # ABO10244) at 1 μg/mL. The immunohistochemical section was developed using SABC method .
    detail
  • IHC - Anti-CHRNA5 Picoband Antibody ABO10244
    CHRNA5 was detected in paraffin-embedded sections of rat cardiac muscle tissues using rabbit anti- CHRNA5 Antigen Affinity purified polyclonal antibody (Catalog # ABO10244) at 1 μg/mL. The immunohistochemical section was developed using SABC method .
    detail
  • IHC - Anti-CHRNA5 Picoband Antibody ABO10244
    CHRNA5 was detected in paraffin-embedded sections of human prostatic cancer tissues using rabbit anti- CHRNA5 Antigen Affinity purified polyclonal antibody (Catalog # ABO10244) at 1 μg/mL. The immunohistochemical section was developed using SABC method .
    detail
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
  • detail
Product Information
Application
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • E=ELISA
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immuno electron microscopy
  • EIA=Enzyme Immunoassay
WB, IHC-P
Primary Accession P30532
Host Rabbit
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Format Lyophilized
Description Rabbit IgG polyclonal antibody for Neuronal acetylcholine receptor subunit alpha-5(CHRNA5) detection. Tested with WB, IHC-P in Human;Mouse;Rat.
Reconstitution Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Additional Information
Gene ID 1138
Other Names Neuronal acetylcholine receptor subunit alpha-5, CHRNA5, NACHRA5
Calculated MW 53054 MW KDa
Application Details Immunohistochemistry(Paraffin-embedded Section), 0.5-1 µg/ml, Human, Mouse, Rat, By Heat

Western blot, 0.1-0.5 µg/ml, Human, Rat
Subcellular Localization Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.
Protein Name Neuronal acetylcholine receptor subunit alpha-5
Contents Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human CHRNA5 (44-76aa AKHEDSLLKDLFQDYERWVRPVEHLNDKIKIKF), different from the related mouse sequence by five amino acids, and from the related rat sequence by four amino acids.
Purification Immunogen affinity purified.
Cross Reactivity No cross reactivity with other proteins
Storage At -20˚C for one year. After r˚Constitution, at 4˚C for one month. It˚Can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Information
Name CHRNA5 (HGNC:1959)
Synonyms NACHRA5
Function Component of neuronal acetylcholine receptors (nAChRs) that function as pentameric, ligand-gated cation channels with high calcium permeability among other activities. nAChRs are excitatory neurotrasnmitter receptors formed by a collection of nAChR subunits known to mediate synaptic transmission in the nervous system and the neuromuscular junction. Each nAchR subunit confers differential attributes to channel properties, including activation, deactivation and desensitization kinetics, pH sensitivity, cation permeability, and binding to allosteric modulators (PubMed:20881005, PubMed:8663494). Has an accessory rather than functional role and is only able to form functional nAChRs when co-assembled with another beta subunit (PubMed:20881005, PubMed:8663494). Participates in pentameric assemblies along with CHRNA3, CHRNA4, CHRNB2 and CHRNB4 (PubMed:20881005, PubMed:8663494). Increases receptor sensitivity to acetylcholine and nicotine when associated with CHRNA4 and CHRNB2 (PubMed:8663494). Plays a role in nicotine addiction (PubMed:20881005).
Cellular Location Synaptic cell membrane {ECO:0000250|UniProtKB:P32297}; Multi-pass membrane protein. Cell membrane {ECO:0000250|UniProtKB:P32297}; Multi-pass membrane protein
Research Areas
Citations (0)
citation

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abcepta antibody to
info@abcepta.com, and receive a free "I Love Antibodies" mug.

Background

Neuronal acetylcholine receptor subunit alpha-5 is a protein that in humans is encoded by the CHRNA5 gene. It is mapped to 15q25.1. The protein encoded by this gene is a nicotinic acetylcholine receptor subunit and a member of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. These receptors are thought to be heteropentamers composed of separate but similar subunits. Defects in this gene have been linked to susceptibility to lung cancer type 2 (LNCR2).

FeedBack
Abcepta welcomes feedback from its customers.

If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abcepta.com.

$ 370.00
Cat# ABO10244
Size:
Quantity:
Availability: 3-5 days
Bulk Size

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaMexicoNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abcepta, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Terms & Conditions
"