Anti-HCN2 Picoband Antibody
- SPECIFICATION
- CITATIONS
- PROTOCOLS
- BACKGROUND
Application
| WB, IHC-P |
---|---|
Primary Accession | Q9UL51 |
Host | Rabbit |
Reactivity | Human, Mouse, Rat |
Clonality | Polyclonal |
Format | Lyophilized |
Description | Rabbit IgG polyclonal antibody for Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2(HCN2) detection. Tested with WB, IHC-P in Human;Mouse;Rat. |
Reconstitution | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Gene ID | 610 |
---|---|
Other Names | Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2, Brain cyclic nucleotide-gated channel 2, BCNG-2, HCN2, BCNG2 |
Calculated MW | 96950 MW KDa |
Application Details | Immunohistochemistry(Paraffin-embedded Section), 0.5-1 µg/ml, Rat, Human, By Heat Western blot, 0.1-0.5 µg/ml, Mouse, Rat, Human |
Subcellular Localization | Cell membrane ; Multi-pass membrane protein . |
Tissue Specificity | Highly expressed throughout the brain. Detected at low levels in heart. . |
Protein Name | Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2 |
Contents | Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3. |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human HCN2 (682-714aa VFNNQENAIIQEIVKYDREMVQQAELGQRVGLF), identical to the related mouse sequence, and different from the related rat sequence by one amino acid. |
Purification | Immunogen affinity purified. |
Cross Reactivity | No cross reactivity with other proteins. |
Storage | At -20˚C for one year. After r˚Constitution, at 4˚C for one month. It˚Can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing. |
Name | HCN2 |
---|---|
Synonyms | BCNG2 |
Function | Hyperpolarization-activated ion channel exhibiting weak selectivity for potassium over sodium ions. Contributes to the native pacemaker currents in heart (If) and in neurons (Ih). Can also transport ammonium in the distal nephron. Produces a large instantaneous current. Modulated by intracellular chloride ions and pH; acidic pH shifts the activation to more negative voltages (By similarity). |
Cellular Location | Cell membrane; Multi-pass membrane protein |
Tissue Location | Highly expressed throughout the brain. Detected at low levels in heart. |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
info@abcepta.com, and receive a free "I Love Antibodies" mug.
Provided below are standard protocols that you may find useful for product applications.
Background
Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated ion channel 2 is a protein that in humans is encoded by the HCN2 gene. The HCN2 gene is localized on human chromosome 19p13.3 and contains eight exons spanning approximately 27 kb. Hyperpolarization-activated cation channels of the HCN gene family, such as HCN2, contribute to spontaneous rhythmic activity in both heart and brain.
If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.
If you have any additional inquiries please email technical services at tech@abcepta.com.