Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
COVID19
>   home   >   Products   >   Primary Antibodies   >   Stem Cells   >   Anti-E2F4 Picoband Antibody   

Anti-E2F4 Picoband Antibody

     
  • WB - Anti-E2F4 Picoband Antibody ABO11675
    Western blot analysis of E2F4 expression in HELA whole cell lysates (lane 1), U20S whole cell lysates (lane 2) and MCF-7 whole cell lysates (lane 3). E2F4 at 44KD, 60KD was detected using rabbit anti- E2F4 Antigen Affinity purified polyclonal antibody (Catalog # ABO11675) at 0.5 μg/mL. The blot was developed using chemiluminescence (ECL) method .
    detail
  • IHC - Anti-E2F4 Picoband Antibody ABO11675
    E2F4 was detected in paraffin-embedded sections of mouse intestine tissues using rabbit anti- E2F4 Antigen Affinity purified polyclonal antibody (Catalog # ABO11675) at 1 μg/mL. The immunohistochemical section was developed using SABC method .
    detail
  • IHC - Anti-E2F4 Picoband Antibody ABO11675
    E2F4 was detected in paraffin-embedded sections of rat intestine tissues using rabbit anti- E2F4 Antigen Affinity purified polyclonal antibody (Catalog # ABO11675) at 1 ??g/mL. The immunohistochemical section was developed using SABC method .
    detail
  • IHC - Anti-E2F4 Picoband Antibody ABO11675
    E2F4 was detected in paraffin-embedded sections of human intetsinal cancer tissues using rabbit anti- E2F4 Antigen Affinity purified polyclonal antibody (Catalog # ABO11675) at 1 μg/mL. The immunohistochemical section was developed using SABC method .
    detail
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
  • detail
Product Information
Application
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • E=ELISA
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immuno electron microscopy
  • EIA=Enzyme Immunoassay
WB, IHC-P
Primary Accession Q16254
Host Rabbit
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Format Lyophilized
Description Rabbit IgG polyclonal antibody for Transcription factor E2F4(E2F4) detection. Tested with WB, IHC-P in Human;Mouse;Rat.
Reconstitution Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Additional Information
Gene ID 1874
Other Names Transcription factor E2F4, E2F-4, E2F4
Calculated MW 43960 MW KDa
Application Details Immunohistochemistry(Paraffin-embedded Section), 0.5-1 µg/ml, Human, Mouse, Rat, By Heat

Western blot, 0.1-0.5 µg/ml, Human
Subcellular Localization Nucleus.
Tissue Specificity Found in all tissue examined including heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.
Protein Name Transcription factor E2F4
Contents Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human E2F4 (106-144aa ELQQREQELDQHKVWVQQSIRNVTEDVQNSCLAYVTHED), identical to the related mouse and rat sequences.
Purification Immunogen affinity purified.
Cross Reactivity No cross reactivity with other proteins
Storage At -20˚C for one year. After r˚Constitution, at 4˚C for one month. It˚Can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Information
Name E2F4
Function Transcription activator that binds DNA cooperatively with DP proteins through the E2 recognition site, 5'-TTTC[CG]CGC-3' found in the promoter region of a number of genes whose products are involved in cell cycle regulation or in DNA replication. The DRTF1/E2F complex functions in the control of cell-cycle progression from G1 to S phase. E2F4 binds with high affinity to RBL1 and RBL2. In some instances can also bind RB1. Specifically required for multiciliate cell differentiation: together with MCIDAS and E2F5, binds and activate genes required for centriole biogenesis.
Cellular Location Nucleus.
Tissue Location Found in all tissue examined including heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas
Research Areas
Citations (0)
citation

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abcepta antibody to
info@abcepta.com, and receive a free "I Love Antibodies" mug.

Background

Transcription factor E2F4 is a protein that in humans is encoded by the E2F4 gene. The protein encoded by this gene is a member of the E2F family of transcription factors. This gene is mapped to 16q22.1. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein binds to all three of the tumor suppressor proteins pRB, p107 and p130, but with higher affinity to the last two. Additionally, it plays an important role in the suppression of proliferation-associated genes, and its gene mutation and increased expression may be associated with human cancer.

FeedBack
Abcepta welcomes feedback from its customers.

If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abcepta.com.

$ 370.00
Cat# ABO11675
Size:
Quantity:
Availability: 3-5 days
Bulk Size

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaMexicoNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abcepta, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Terms & Conditions
"