Foundational characteristics of cancer include proliferation, angiogenesis, migration, evasion of apoptosis, and cellular immortality. Find key markers for these cellular processes and antibodies to detect them.
The SUMOplot™ Analysis Program predicts and scores sumoylation sites in your protein. SUMOylation is a post-translational modification involved in various cellular processes, such as nuclear-cytosolic transport, transcriptional regulation, apoptosis, protein stability, response to stress, and progression through the cell cycle.
The Autophagy Receptor Motif Plotter predicts and scores autophagy receptor binding sites in your protein. Identifying proteins connected to this pathway is critical to understanding the role of autophagy in physiological as well as pathological processes such as development, differentiation, neurodegenerative diseases, stress, infection, and cancer.
Anti-BCRP/ABCG2 Picoband Antibody
- SPECIFICATION
- CITATIONS
- PROTOCOLS
- BACKGROUND
Application 
| WB, IHC-P, IHC-F, FC, ICC |
|---|---|
| Primary Accession | Q9UNQ0 |
| Host | Rabbit |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Format | Lyophilized |
| Description | Rabbit IgG polyclonal antibody for ATP-binding cassette sub-family G member 2(ABCG2) detection. Tested with WB, IHC-P, IHC-F, ICC, FCM in Human;Mouse;Rat. |
| Reconstitution | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
| Gene ID | 9429 |
|---|---|
| Other Names | ATP-binding cassette sub-family G member 2, Breast cancer resistance protein, CDw338, Mitoxantrone resistance-associated protein, Placenta-specific ATP-binding cassette transporter, Urate exporter, CD338, ABCG2, ABCP, BCRP, BCRP1, MXR |
| Calculated MW | 72314 MW KDa |
| Application Details | Immunohistochemistry(Frozen Section), 0.5-1 µg/ml Immunohistochemistry(Paraffin-embedded Section), 0.5-1 µg/ml, By Heat Immunocytochemistry, 0.5-1 µg/ml Western blot, 0.1-0.5 µg/ml Flow Cytometry, 1-3μg/1x106cells |
| Subcellular Localization | Cell membrane; Multi-pass membrane protein. Mitochondrion membrane; Multi-pass membrane protein. |
| Tissue Specificity | Highly expressed in placenta. Low expression in small intestine, liver and colon. . |
| Protein Name | ATP-binding cassette sub-family G member 2 |
| Contents | Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3. |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human ABCG2(137-168aa RENLQFSAALRLATTMTNHEKNERINRVIQEL), different from the related mouse sequence by five amino acids, and from the related rat sequence by eight amino acids. |
| Purification | Immunogen affinity purified. |
| Cross Reactivity | No cross reactivity with other proteins. |
| Storage | At -20˚C for one year. After r˚Constitution, at 4˚C for one month. It˚Can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing. |
| Sequence Similarities | Belongs to the ABC transporter superfamily. ABCG family. Eye pigment precursor importer (TC 3.A.1.204) subfamily. |
| Name | ABCG2 |
|---|---|
| Synonyms | ABCP, BCRP, BCRP1, MXR |
| Function | Broad substrate specificity ATP-dependent transporter of the ATP-binding cassette (ABC) family that actively extrudes a wide variety of physiological compounds, dietary toxins and xenobiotics from cells (PubMed:11306452, PubMed:12958161, PubMed:19506252, PubMed:20705604, PubMed:28554189, PubMed:30405239, PubMed:31003562). Involved in porphyrin homeostasis, mediating the export of protoporphyrin IX (PPIX) from both mitochondria to cytosol and cytosol to extracellular space, it also functions in the cellular export of heme (PubMed:20705604, PubMed:23189181). Also mediates the efflux of sphingosine-1-P from cells (PubMed:20110355). Acts as a urate exporter functioning in both renal and extrarenal urate excretion (PubMed:19506252, PubMed:20368174, PubMed:22132962, PubMed:31003562, PubMed:36749388). In kidney, it also functions as a physiological exporter of the uremic toxin indoxyl sulfate (By similarity). Also involved in the excretion of steroids like estrone 3-sulfate/E1S, 3beta-sulfooxy-androst-5-en-17-one/DHEAS, and other sulfate conjugates (PubMed:12682043, PubMed:28554189, PubMed:30405239). Mediates the secretion of the riboflavin and biotin vitamins into milk (By similarity). Extrudes pheophorbide a, a phototoxic porphyrin catabolite of chlorophyll, reducing its bioavailability (By similarity). Plays an important role in the exclusion of xenobiotics from the brain (Probable). It confers to cells a resistance to multiple drugs and other xenobiotics including mitoxantrone, pheophorbide, camptothecin, methotrexate, azidothymidine, and the anthracyclines daunorubicin and doxorubicin, through the control of their efflux (PubMed:11306452, PubMed:12477054, PubMed:15670731, PubMed:18056989, PubMed:31254042). In placenta, it limits the penetration of drugs from the maternal plasma into the fetus (By similarity). May play a role in early stem cell self-renewal by blocking differentiation (By similarity). |
| Cellular Location | Cell membrane; Multi-pass membrane protein. Apical cell membrane; Multi-pass membrane protein. Mitochondrion membrane; Multi-pass membrane protein. Note=Enriched in membrane lipid rafts |
| Tissue Location | Highly expressed in placenta (PubMed:9850061). Low expression in small intestine, liver and colon (PubMed:9861027) Expressed in brain (at protein level) (PubMed:12958161) |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
info@abcepta.com, and receive a free "I Love Antibodies" mug.
Provided below are standard protocols that you may find useful for product applications.
Background
ABCG2(Atp-binding cassette, subfamily g, member 2) also known as ABCP, BCRP or MRX, is a protein that in humans is encoded by the ABCG2 gene. The ABCG2 gene encodes a membrane transporter belonging to the ATP-binding cassette (ABC) superfamily of membrane transporters, which are involved in the trafficking of biologic molecules across cell membranes. The ABCG2 protein is also a high capacity transporter for uric acid excretion in the kidney, liver, and gut. The ABCG2 gene is mapped on 4q22.1. In vitro assays of isolated membrane preparations revealed a high-capacity, vanadate-sensitive ATPase activity associated with ABCG2 expression that was stimulated by compounds known to be transported by this protein. Ozvegy et al. (2001) concluded that ABCG2 is likely functioning as a homodimer or homooligomer in this expression system since it is unlikely that putative Sf9 transport partners would be overexpressed at similarly high levels.Abcg2 transports pheophorbide-a, which occurs in various plant-derived foods and food supplements and is highly efficient in limiting its uptake from ingested food. ABCG2 is a major factor in the concentrative transfer of drugs, carcinogens, and dietary toxins to the milk of mice, cows, and humans.
If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.
If you have any additional inquiries please email technical services at tech@abcepta.com.
Ordering Information
Other Products
Shipping Information
