Anti-Flt-3ligand Antibody
- SPECIFICATION
- CITATIONS
- PROTOCOLS
- BACKGROUND
Application ![]()
| WB |
---|---|
Primary Accession | P49771 |
Host | Rabbit |
Reactivity | Human, Rat |
Clonality | Polyclonal |
Format | Lyophilized |
Description | Rabbit IgG polyclonal antibody for Fms-related tyrosine kinase 3 ligand(FLT3LG) detection. Tested with WB in Human;Rat. |
Reconstitution | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Gene ID | 2323 |
---|---|
Other Names | Fms-related tyrosine kinase 3 ligand, Flt3 ligand, Flt3L, SL cytokine, FLT3LG |
Calculated MW | 26416 MW KDa |
Application Details | Western blot, 0.1-0.5 µg/ml, Human, Rat |
Subcellular Localization | Isoform 1: Cell membrane; Single-pass type I membrane protein. |
Protein Name | Fms-related tyrosine kinase 3 ligand |
Contents | Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3. |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human Flt-3ligand (79-110aa AQRWMERLKTVAGSKMQGLLERVNTEIHFVTK), different from the related mouse sequence by four amino acids. |
Purification | Immunogen affinity purified. |
Cross Reactivity | No cross reactivity with other proteins |
Storage | At -20˚C for one year. After r˚Constitution, at 4˚C for one month. It˚Can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing. |
Name | FLT3LG |
---|---|
Function | Stimulates the proliferation of early hematopoietic cells by activating FLT3. Synergizes well with a number of other colony stimulating factors and interleukins. Required for the development of B cells, and dendritic cells (DCs). |
Cellular Location | [Isoform 1]: Cell membrane; Single-pass type I membrane protein |

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
info@abcepta.com, and receive a free "I Love Antibodies" mug.
Provided below are standard protocols that you may find useful for product applications.
Background
FLT3LG (FMS-Related Tyrosine Kinase 3 Ligand) also called FLT3 LIGAND, FL or FLT3L, is a protein which in humans is encoded by the FLT3LG gene. FLT3LG controls the development of DCs and is particularly important for plasmacytoid DCs and CD8-positive classical DCs and their CD103-positive tissue counterparts. Flt3 ligand (FL) is a hematopoietic four helical bundlecytokine. It is structurally homologous to stem cell factor (SCF) and colony stimulating facor 1 (CSF-1). In synergy with other growth factors, Flt3 ligand stimulates the proliferation and differentiation of various blood cell progenitors. Lyman et al. (1993) found that Flt3 ligand stimulated proliferation of hematopoietic progenitor cells isolated from mouse fetal liver or adult mouse bone marrow. Hannum et al. (1994) concluded that FL enhances the response of stem and primitive progenitor cells to other growth factors to generate all myeloid lineages except erythroid cells. Assays of C-terminally truncated FL proteins confirmed that the N-terminal half conferred FL activity. Depletion of the Pi3k -Mtor negative regulator Pten facilitated Flt3l-driven DC development in culture.

If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.
If you have any additional inquiries please email technical services at tech@abcepta.com.