Anti-Connexin 45/GJA7 Picoband Antibody
- SPECIFICATION
- CITATIONS
- PROTOCOLS
- BACKGROUND
Application
| WB |
---|---|
Primary Accession | P36383 |
Host | Rabbit |
Reactivity | Human, Rat |
Clonality | Polyclonal |
Format | Lyophilized |
Description | Rabbit IgG polyclonal antibody for Gap junction gamma-1 protein(GJC1) detection. Tested with WB in Human;Rat. |
Reconstitution | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Gene ID | 10052 |
---|---|
Other Names | Gap junction gamma-1 protein, Connexin-45, Cx45, Gap junction alpha-7 protein, GJC1, GJA7 |
Calculated MW | 45470 MW KDa |
Application Details | Western blot, 0.1-0.5 µg/ml, Human, Rat |
Subcellular Localization | Cell membrane; Multi-pass membrane protein. Cell junction, gap junction. |
Protein Name | Gap junction gamma-1 protein |
Contents | Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3. |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human Connexin 45/GJA7 (333-363aa ADLEALQREIRMAQERLDLAVQAYSHQNNP H), different from the related mouse and rat sequences by three amino acids. |
Purification | Immunogen affinity purified. |
Cross Reactivity | No cross reactivity with other proteins |
Storage | At -20˚C for one year. After r˚Constitution, at 4˚C for one month. It˚Can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing. |
Name | GJC1 |
---|---|
Synonyms | GJA7 |
Function | One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell. |
Cellular Location | Cell membrane; Multi-pass membrane protein. Cell junction, gap junction |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
info@abcepta.com, and receive a free "I Love Antibodies" mug.
Provided below are standard protocols that you may find useful for product applications.
Background
Gap junction gamma-1 protein (GJC1), also known as gap junction alpha-7 protein (GJA7) or connexin 45 (Cx45), is a protein that in humans is encoded by the GJC1 gene. The International Radiation Hybrid Mapping Consortium mapped the GJA7 gene to chromosome 17q21.31. This gene is a member of the connexin gene family. The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell.
If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.
If you have any additional inquiries please email technical services at tech@abcepta.com.