Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
COVID19
>   home   >   Products   >   Primary Antibodies   >   Antibody Collections   >   Antiviral defense   >   Anti-IRF5 Picoband Antibody   

Anti-IRF5 Picoband Antibody

     
  • WB - Anti-IRF5 Picoband Antibody ABO12332
    Anti- IRF5 Picoband antibody, ABO12332, Western blottingAll lanes: Anti IRF5 (ABO12332) at 0.5ug/mlLane 1: Rat Intestine Tissue Lysate at 50ugLane 2: HELA Whole Cell Lysate at 40ugLane 3: COLO320 Whole Cell Lysate at 40ugLane 4: NIH3T3 Whole Cell Lysate at 40ugLane 5: HEPA Whole Cell Lysate at 40ugPredicted bind size: 56KDObserved bind size: 56KD
    detail
  • IHC - Anti-IRF5 Picoband Antibody ABO12332
    Anti- IRF5 Picoband antibody, ABO12332, IHC(P)IHC(P): Mouse Spleen Tissue
    detail
  • IHC - Anti-IRF5 Picoband Antibody ABO12332
    Anti- IRF5 Picoband antibody, ABO12332, IHC(P)IHC(P): Rat Spleen Tissue
    detail
  • IHC - Anti-IRF5 Picoband Antibody ABO12332
    Anti- IRF5 Picoband antibody, ABO12332, IHC(P)IHC(P): Human Mammary Cancer Tissue
    detail
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
  • detail
Product Information
Application
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • E=ELISA
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immuno electron microscopy
  • EIA=Enzyme Immunoassay
WB, IHC-P
Primary Accession Q13568
Host Rabbit
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Format Lyophilized
Description Rabbit IgG polyclonal antibody for Interferon regulatory factor 5(IRF5) detection. Tested with WB, IHC-P in Human;Mouse;Rat.
Reconstitution Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Additional Information
Gene ID 3663
Other Names Interferon regulatory factor 5, IRF-5, IRF5
Calculated MW 56044 MW KDa
Application Details Immunohistochemistry(Paraffin-embedded Section), 0.5-1 µg/ml, Human, Mouse, Rat, By Heat

Western blot, 0.1-0.5 µg/ml, Human, Mouse, Rat
Subcellular Localization Cytoplasm. Nucleus. Shuttles between the nucleus and the cytoplasm.
Protein Name Interferon regulatory factor 5
Contents Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human IRF5 (442-472aa RLQISNPDLKDRMVEQFKELHHIWQSQQRLQ), different from the related mouse sequence by three amino acids.
Purification Immunogen affinity purified.
Cross Reactivity No cross reactivity with other proteins
Storage At -20˚C for one year. After r˚Constitution, at 4˚C for one month. It˚Can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Information
Name IRF5 {ECO:0000303|PubMed:11303025, ECO:0000312|HGNC:HGNC:6120}
Function Transcription factor that plays a critical role in innate immunity by activating expression of type I interferon (IFN) IFNA and INFB and inflammatory cytokines downstream of endolysosomal toll-like receptors TLR7, TLR8 and TLR9 (PubMed:11303025, PubMed:15695821, PubMed:22412986, PubMed:25326418, PubMed:32433612). Regulates the transcription of type I IFN genes (IFN-alpha and IFN-beta) and IFN- stimulated genes (ISG) by binding to an interferon-stimulated response element (ISRE) in their promoters (By similarity). Can efficiently activate both the IFN-beta (IFNB) and the IFN-alpha (IFNA) genes and mediate their induction downstream of the TLR-activated, MyD88- dependent pathway (By similarity). Key transcription factor regulating the IFN response during SARS-CoV-2 infection (PubMed:33440148).
Cellular Location Cytoplasm. Nucleus. Note=Shuttles between the nucleus and the cytoplasm: upon activation by the TLR adapter MYD88 and subsequent phosphorylation, translocates to the nucleus
Research Areas
Citations (0)
citation

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abcepta antibody to
info@abcepta.com, and receive a free "I Love Antibodies" mug.

Background

Interferon regulatory factor 5, also called IRF5 or SLEB10, is a protein that in humans is encoded by the IRF5 gene. IRF5 gene is mapped to 7q32.1. This gene encodes a member of the interferon regulatory factor (IRF) family, a group of transcription factors with diverse roles, including virus-mediated activation of interferon, and modulation of cell growth, differentiation, apoptosis, and immune system activity. Members of the IRF family are characterized by a conserved N-terminal DNA-binding domain containing tryptophan (W) repeats. Multiple transcript variants encoding different isoforms have been found for this gene, and a 30-nt indel polymorphism (SNP rs60344245) can result in loss of a 10-aa segment. This gene is a transcription factor involved in the induction of interferons IFNA and INFB and inflammatory cytokines upon virus infection.

FeedBack
Abcepta welcomes feedback from its customers.

If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abcepta.com.

$ 370.00
Cat# ABO12332
Size:
Quantity:
Availability: 3-5 days
Bulk Size

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaMexicoNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abcepta, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Terms & Conditions
"