Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
COVID19
>   home   >   Products   >   Primary Antibodies   >   Antibody Collections   >   SARS-Human interaction partners   >   Anti-IGFBP5 Picoband Antibody   

Anti-IGFBP5 Picoband Antibody

     
  • WB - Anti-IGFBP5 Picoband Antibody ABO12397
    Anti- IGFBP5 Picoband antibody, ABO12397, Western blottingAll lanes: Anti IGFBP5 (ABO12397) at 0.5ug/mlLane 1: U20S Whole Cell Lysate at 40ugLane 2: HELA Whole Cell Lysate at 40ugPredicted bind size: 31KDObserved bind size: 23KD
    detail
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
  • detail
Product Information
Application
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • E=ELISA
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immuno electron microscopy
  • EIA=Enzyme Immunoassay
WB, E
Primary Accession P24593
Host Rabbit
Reactivity Human
Clonality Polyclonal
Format Lyophilized
Description Rabbit IgG polyclonal antibody for Insulin-like growth factor-binding protein 5(IGFBP5) detection. Tested with WB, ELISA in Human.
Reconstitution Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Additional Information
Gene ID 3488
Other Names Insulin-like growth factor-binding protein 5, IBP-5, IGF-binding protein 5, IGFBP-5, IGFBP5, IBP5
Calculated MW 30570 MW KDa
Application Details ELISA , 0.1-0.5 µg/ml, Human, -
Western blot, 0.1-0.5 µg/ml, Human
Subcellular Localization Secreted.
Tissue Specificity Osteosarcoma, and at lower levels in liver, kidney and brain.
Protein Name Insulin-like growth factor-binding protein 5
Contents Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human IGFBP5 (76-114aa QGLRCLPRQDEEKPLHALLHGRGVCLNEKSYREQVKIER), different from the related mouse and rat sequences by two amino acids.
Purification Immunogen affinity purified.
Cross Reactivity No cross reactivity with other proteins
Storage At -20˚C for one year. After r˚Constitution, at 4˚C for one month. It˚Can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Information
Name IGFBP5
Synonyms IBP5
Function Multifunctional protein that plays a critical role in regulating the availability of IGFs to their receptors and thereby regulates IGF-mediated cellular processes including proliferation, differentiation, and apoptosis in a cell-type specific manner (PubMed:18930415, PubMed:7683690). Increases the cell proliferation of osteoblasts, intestinal smooth muscle cells and neuroblastoma cells. Enhances adhesion and survival of epithelial cells but decreases adhesion of mesenchymal cells (By similarity). Once secreted, acts as a major mediator of mTORC1-dependent feedback inhibition of IGF1 signaling (By similarity). Also plays a role in the induction of extracellular matrix (ECM) production and deposition independently of its nuclear translocation and binding to IGFs (PubMed:20345844, PubMed:26103640). Acts itself as a growth factor that can act independently of IGFs to regulate bone formation. Acts as a ligand for the ROR1 receptor which triggers formation of ROR1/HER2 heterodimer to enhance CREB oncogenic signaling (PubMed:36949068).
Cellular Location Secreted. Cytoplasm. Nucleus
Tissue Location Osteosarcoma, and at lower levels in liver, kidney and brain
Research Areas
Citations (0)
citation

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abcepta antibody to
info@abcepta.com, and receive a free "I Love Antibodies" mug.

Background

Insulin-like growth factor-binding protein 5 is a protein that in humans is encoded by the IGFBP5 gene. The expression of IGFBP5 by stable transfection and adenovirus-mediated infection is inhibitory to growth in 2 human breast cancer cell lines. IGFBP5 expression leads to G2/M cell cycle arrest and apoptosis. Stable expression of IGFBP5 in the breast cancer cell lines also inhibits the formation and growth of tumors following injection in athymic mice. It is concluded that IGFBP5 is a growth inhibitor and proapoptotic agent in breast cancer cells. Additionally, IGFBP-5 is expressed by fibroblasts, myoblasts and osteoblasts, making it the predominant IGFBP found in bone extracts. It has a strong affinity for hydroxyapatite, allowing it to bind to bone cells. When bound to extracellular matrix, IGFBP-5 is protected from proteolysis and potentiates IGF activity, but when it is soluble, IGFBP-5 is cleaved to a biologically inactive 21 kDa fragment (1, 2).

FeedBack
Abcepta welcomes feedback from its customers.

If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abcepta.com.

$ 370.00
Cat# ABO12397
Size:
Quantity:
Availability: 3-5 days
Bulk Size

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaMexicoNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abcepta, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Terms & Conditions
"