Anti-NUR77 Picoband Antibody
- SPECIFICATION
- CITATIONS
- PROTOCOLS
- BACKGROUND

Application
| WB |
|---|---|
| Primary Accession | P22736 |
| Host | Rabbit |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Format | Lyophilized |
| Description | Rabbit IgG polyclonal antibody for Nuclear receptor subfamily 4 group A member 1(NR4A1) detection. Tested with WB in Human;Mouse;Rat. |
| Reconstitution | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
| Gene ID | 3164 |
|---|---|
| Other Names | Nuclear receptor subfamily 4 group A member 1, Early response protein NAK1, Nuclear hormone receptor NUR/77, Nur77, Orphan nuclear receptor HMR, Orphan nuclear receptor TR3, ST-59, Testicular receptor 3, NR4A1, GFRP1, HMR, NAK1 |
| Calculated MW | 64463 MW KDa |
| Application Details | Western blot, 0.1-0.5 µg/ml, Human, Mouse, Rat |
| Subcellular Localization | Cytoplasm. Nucleus. |
| Tissue Specificity | Fetal muscle and adult liver, brain and thyroid. |
| Protein Name | Nuclear receptor subfamily 4 group A member 1 |
| Contents | Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3. |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human NUR77 (372-408aa HLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYD), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids. |
| Purification | Immunogen affinity purified. |
| Cross Reactivity | No cross reactivity with other proteins. |
| Storage | At -20˚C for one year. After r˚Constitution, at 4˚C for one month. It˚Can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing. |
| Name | NR4A1 |
|---|---|
| Synonyms | GFRP1, HMR, NAK1 |
| Function | Orphan nuclear receptor. Binds the NGFI-B response element (NBRE) 5'-AAAGGTCA-3' (PubMed:18690216, PubMed:8121493, PubMed:9315652). Binds 9-cis-retinoic acid outside of its ligand- binding (NR LBD) domain (PubMed:18690216). Participates in energy homeostasis by sequestrating the kinase STK11 in the nucleus, thereby attenuating cytoplasmic AMPK activation (PubMed:22983157). Regulates the inflammatory response in macrophages by regulating metabolic adaptations during inflammation, including repressing the transcription of genes involved in the citric acid cycle (TCA) (By similarity). Inhibits NF-kappa-B signaling by binding to low-affinity NF-kappa-B binding sites, such as at the IL2 promoter (PubMed:15466594). May act concomitantly with NR4A2 in regulating the expression of delayed-early genes during liver regeneration (By similarity). Plays a role in the vascular response to injury (By similarity). |
| Cellular Location | Nucleus. Cytoplasm, cytosol. Mitochondrion Note=Nuclear export to the cytosol is XPO1-mediated and positively regulated by IFI27 (PubMed:22427340). Translocation to the mitochondrion upon interaction with RXRA and upon the presence of 9-cis retinoic acid (PubMed:17761950). |
| Tissue Location | Fetal muscle and adult liver, brain and thyroid. |

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
info@abcepta.com, and receive a free "I Love Antibodies" mug.
Provided below are standard protocols that you may find useful for product applications.
Background
NR4A1 (NUCLEAR RECEPTOR SUBFAMILY 4, GROUP A, MEMBER 1), also called NAK1, GFRP1, TR3, NUR77 or NGFIB, is a protein that in humans is encoded by the NR4A1 gene, which is also a member of the Nur nuclear receptor family of intracellular transcription factors. The NR4A1 gene is mapped on 12q13.13. NR4A1 is involved in cell cycle mediation, inflammation and apoptosis. It plays a key role in mediating inflammatory responses in macrophages. In addition, subcellular localization of the NR4A1 protein appears to play a key role in the survival and death of cells. Nr4a1 is overexpressed in Wnt1 -transformed mouse mammary cells. Nr4a1 is also induced by lithium, a Wnt1 mimic, and the Nr4a1 promoter is activated by lithium and beta-catenin, a Wnt1 downstream effector. In contrast, human NR4A1 is not upregulated by beta-catenin, indicating that this gene is regulated differently in human and mouse cells. Adenoviral expression of Nr4a1 induces genes involved in gluconeogenesis, stimulates glucose production both in vitro and in vivo, and raises blood glucose levels.
If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.
If you have any additional inquiries please email technical services at tech@abcepta.com.





Foundational characteristics of cancer include proliferation, angiogenesis, migration, evasion of apoptosis, and cellular immortality. Find key markers for these cellular processes and antibodies to detect them.
The SUMOplot™ Analysis Program predicts and scores sumoylation sites in your protein. SUMOylation is a post-translational modification involved in various cellular processes, such as nuclear-cytosolic transport, transcriptional regulation, apoptosis, protein stability, response to stress, and progression through the cell cycle.
The Autophagy Receptor Motif Plotter predicts and scores autophagy receptor binding sites in your protein. Identifying proteins connected to this pathway is critical to understanding the role of autophagy in physiological as well as pathological processes such as development, differentiation, neurodegenerative diseases, stress, infection, and cancer.


