Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
COVID19
>   home   >   Products   >   Primary Antibodies   >   Antibody Collections   >   Host-virus interaction   >   Anti-TAP2 Picoband Antibody   

Anti-TAP2 Picoband Antibody

     
  • WB - Anti-TAP2 Picoband Antibody ABO12510
    Anti-TAP2 Picoband antibody, ABO12510, Western blottingAll lanes: Anti TAP2 (ABO12510) at 0.5ug/mlWB: HELA Whole Cell Lysate at 40ugPredicted bind size: 87KDObserved bind size: 87KD
    detail
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
  • detail
Product Information
Application
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • E=ELISA
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immuno electron microscopy
  • EIA=Enzyme Immunoassay
WB
Primary Accession Q03519
Host Rabbit
Reactivity Human
Clonality Polyclonal
Format Lyophilized
Description Rabbit IgG polyclonal antibody for Antigen peptide transporter 2(TAP2) detection. Tested with WB in Human.
Reconstitution Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Additional Information
Gene ID 6891
Other Names Antigen peptide transporter 2, APT2, ATP-binding cassette sub-family B member 3, Peptide supply factor 2, Peptide transporter PSF2, PSF-2, Peptide transporter TAP2, Peptide transporter involved in antigen processing 2, Really interesting new gene 11 protein, TAP2, ABCB3, PSF2, RING11, Y1
Calculated MW 75664 MW KDa
Application Details Western blot, 0.1-0.5 µg/ml, Human
Subcellular Localization Endoplasmic reticulum membrane; Multi-pass membrane protein. The transmembrane segments seem to form a pore in the membrane.
Protein Name Antigen peptide transporter 2
Contents Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human TAP2 (611-651aa QKQRLAIARALVRDPRVLILDEATSALDVQCEQALQDWNSR), different from the related mouse sequence by five amino acids, and from the related rat sequence by six amino acids.
Purification Immunogen affinity purified.
Cross Reactivity No cross reactivity with other proteins
Storage At -20˚C for one year. After r˚Constitution, at 4˚C for one month. It˚Can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Information
Name TAP2 {ECO:0000303|PubMed:10605026, ECO:0000312|HGNC:HGNC:44}
Function ABC transporter associated with antigen processing. In complex with TAP1 mediates unidirectional translocation of peptide antigens from cytosol to endoplasmic reticulum (ER) for loading onto MHC class I (MHCI) molecules (PubMed:25377891, PubMed:25656091). Uses the chemical energy of ATP to export peptides against the concentration gradient (PubMed:25377891). During the transport cycle alternates between 'inward-facing' state with peptide binding site facing the cytosol to 'outward-facing' state with peptide binding site facing the ER lumen. Peptide antigen binding to ATP-loaded TAP1-TAP2 induces a switch to hydrolysis-competent 'outward-facing' conformation ready for peptide loading onto nascent MHCI molecules. Subsequently ATP hydrolysis resets the transporter to the 'inward facing' state for a new cycle (PubMed:11274390, PubMed:25377891, PubMed:25656091). Typically transports intracellular peptide antigens of 8 to 13 amino acids that arise from cytosolic proteolysis via IFNG-induced immunoproteasome. Binds peptides with free N- and C-termini, the first three and the C-terminal residues being critical. Preferentially selects peptides having a highly hydrophobic residue at position 3 and hydrophobic or charged residues at the C-terminal anchor. Proline at position 2 has the most destabilizing effect (PubMed:11274390, PubMed:7500034, PubMed:9256420). As a component of the peptide loading complex (PLC), acts as a molecular scaffold essential for peptide-MHCI assembly and antigen presentation (PubMed:1538751, PubMed:25377891, PubMed:26611325).
Cellular Location Endoplasmic reticulum membrane; Multi-pass membrane protein. Note=The transmembrane segments seem to form a pore in the membrane
Research Areas
Citations (0)
citation

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abcepta antibody to
info@abcepta.com, and receive a free "I Love Antibodies" mug.

Background

Transporter, ATP-binding cassette, major histocompatibility complex 2(TAP2) is a gene in humans that encodes the protein Antigen peptide transporter 2. The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. The gene is assigned to human chromosome 6p21.3. It is located 7 kb telomeric to gene family member ABCB2. The protein encoded by this gene is involved in antigen presentation. And this protein forms a heterodimer with ABCB2 in order to transport peptides from the cytoplasm to the endoplasmic reticulum.

FeedBack
Abcepta welcomes feedback from its customers.

If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abcepta.com.

$ 370.00
Cat# ABO12510
Size:
Quantity:
Availability: 3-5 days
Bulk Size

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthersMexico
Abcepta, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Terms & Conditions
"