Anti-ZP2 Picoband Antibody
- SPECIFICATION
- CITATIONS
- PROTOCOLS
- BACKGROUND
Application
| WB, IHC-P, IHC-F |
---|---|
Primary Accession | Q05996 |
Host | Rabbit |
Reactivity | Human, Mouse, Rat |
Clonality | Polyclonal |
Format | Lyophilized |
Description | Rabbit IgG polyclonal antibody for Zona pellucida sperm-binding protein 2(ZP2) detection. Tested with WB, IHC-P, IHC-F in Human;Mouse;Rat. |
Reconstitution | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Gene ID | 7783 |
---|---|
Other Names | Zona pellucida sperm-binding protein 2, Zona pellucida glycoprotein 2, Zp-2, Zona pellucida protein A, Processed zona pellucida sperm-binding protein 2, ZP2, ZPA |
Calculated MW | 82357 MW KDa |
Application Details | Immunohistochemistry(Paraffin-embedded Section), 0.5-1 µg/ml, By Heat Western blot, 0.1-0.5 µg/ml Immunohistochemistry(Frozen Section), 0.5-1 µg/ml |
Subcellular Localization | Processed zona pellucida sperm-binding protein 2: Secreted, extracellular space, extracellular matrix . The glycoproteinaceous translucent extracellular matrix that surrounds the mammalian oocyte is called zona pellucida. . |
Protein Name | Zona pellucida sperm-binding protein 2 |
Contents | Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3. |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human ZP2 (511-544aa ENEYPLVRFLRQPIYMEVRVLNRDDPNIKLVLDD), different from the related mouse sequence by six amino acids, and from the related rat sequence by four amino acids. |
Purification | Immunogen affinity purified. |
Cross Reactivity | No cross reactivity with other proteins. |
Storage | At -20˚C for one year. After r˚Constitution, at 4˚C for one month. It˚Can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing. |
Name | ZP2 |
---|---|
Synonyms | ZPA |
Function | Component of the zona pellucida, an extracellular matrix surrounding oocytes which mediates sperm binding, induction of the acrosome reaction and prevents post-fertilization polyspermy (PubMed:29895852). The zona pellucida is composed of 3 to 4 glycoproteins, ZP1, ZP2, ZP3, and ZP4. ZP2 may act as a secondary sperm receptor (PubMed:29895852). |
Cellular Location | [Processed zona pellucida sperm-binding protein 2]: Zona pellucida |
Tissue Location | Expressed in occytes(at protein level). |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
info@abcepta.com, and receive a free "I Love Antibodies" mug.
Provided below are standard protocols that you may find useful for product applications.
Background
Zona pellucida sperm-binding protein 2 is a protein that in humans is encoded by the ZP2 gene. The sperm-binding domain on the ZP2 protein is necessary in both humans and mice for oocyte-sperm recognition and penetration of the zona pellucida. It is also responsible for the primary block to polyspermy in mammals. The oocyte has cortical granules peripherally located under the cortex that contain a proteolytic protein called ovastacin. After the sperm binds to ZP2, the cortical granules are exocytosed releasing ovastacin into the perivitelline space. Ovastacin cleaves ZP2 at the N terminus, preventing more sperm from binding and penetrating the oocyte, thus hardening the zona pellucida. Ovastacin is only found in oocytes, and is part of the astacin family of metalloendoproteases. Female mice engineered without ovastacin showed that ZP2 was not cleaved after fertilization.
If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.
If you have any additional inquiries please email technical services at tech@abcepta.com.