Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
COVID19
>   home   >   Products   >   Primary Antibodies   >   Stem Cells   >   Anti-FABP2/I-FABP Picoband Antibody   

Anti-FABP2/I-FABP Picoband Antibody

     
  • WB - Anti-FABP2/I-FABP Picoband Antibody ABO12628
    Western blot analysis of FABP2/I-FABP expression in SW620 whole cell lysates (lane 1). FABP2/I-FABP at 15KD was detected using rabbit anti- FABP2/I-FABP Antigen Affinity purified polyclonal antibody (Catalog # ABO12628) at 0.5 μg/mL. The blot was developed using chemiluminescence (ECL) method .
    detail
  • IHC - Anti-FABP2/I-FABP Picoband Antibody ABO12628
    FABP2/I-FABP was detected in paraffin-embedded sections of mouse intestine tissues using rabbit anti- FABP2/I-FABP Antigen Affinity purified polyclonal antibody (Catalog # ABO12628) at 1 μg/mL. The immunohistochemical section was developed using SABC method .
    detail
  • IHC - Anti-FABP2/I-FABP Picoband Antibody ABO12628
    FABP2/I-FABP was detected in paraffin-embedded sections of rat intestine tissues using rabbit anti- FABP2/I-FABP Antigen Affinity purified polyclonal antibody (Catalog # ABO12628) at 1 μg/mL. The immunohistochemical section was developed using SABC method .
    detail
  • IHC - Anti-FABP2/I-FABP Picoband Antibody ABO12628
    FABP2/I-FABP was detected in paraffin-embedded sections of human intestinal cancer tissues using rabbit anti- FABP2/I-FABP Antigen Affinity purified polyclonal antibody (Catalog # ABO12628) at 1 ??g/mL. The immunohistochemical section was developed using SABC method .
    detail
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
  • detail
Product Information
Application
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • E=ELISA
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immuno electron microscopy
  • EIA=Enzyme Immunoassay
WB, IHC, IHC-P, IF, IC, ICC
Primary Accession P12104
Host Rabbit
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Format Lyophilized
Description Rabbit IgG polyclonal antibody for Fatty acid-binding protein, intestinal(FABP2) detection. Tested with WB, IHC-P in Human;Mouse;Rat.
Reconstitution Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Additional Information
Gene ID 2169
Other Names Fatty acid-binding protein, intestinal, Fatty acid-binding protein 2, Intestinal-type fatty acid-binding protein, I-FABP, FABP2, FABPI
Calculated MW 15207 MW KDa
Application Details Immunohistochemistry(Paraffin-embedded Section), 0.5-1 µg/ml, Human, Mouse, Rat, By Heat

Western blot, 0.1-0.5 µg/ml, Human
Subcellular Localization Cytoplasm.
Tissue Specificity Expressed in the small intestine and at much lower levels in the large intestine. Highest expression levels in the jejunum. .
Protein Name Fatty acid-binding protein, intestinal
Contents Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human FABP2/I-FABP (2-38aa AFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLK), different from the related mouse sequence by seven amino acids, and from the related rat sequence by six amino acids
Purification Immunogen affinity purified.
Cross Reactivity No cross reactivity with other proteins
Storage At -20˚C for one year. After r˚Constitution, at 4˚C for one month. It˚Can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Information
Name FABP2
Synonyms FABPI
Function FABPs are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters. FABP2 is probably involved in triglyceride-rich lipoprotein synthesis. Binds saturated long-chain fatty acids with a high affinity, but binds with a lower affinity to unsaturated long-chain fatty acids. FABP2 may also help maintain energy homeostasis by functioning as a lipid sensor.
Cellular Location Cytoplasm.
Tissue Location Expressed in the small intestine and at much lower levels in the large intestine. Highest expression levels in the jejunum.
Research Areas
Citations (0)
citation

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abcepta antibody to
info@abcepta.com, and receive a free "I Love Antibodies" mug.

Background

FABP 2, Fatty acid-binding protein 2, is a protein that in humans is encoded by the FABP2 gene. Using a human cDNA probe, the gene is assigned to chromosome 4 in somatic cell hybrids. FABP 2 gene contains four exons and is an abundant cytosolic protein in small intestine epithelial cells. The FABPs belong to a multigene family with nearly twenty identified members. And FABPs are divided into at least three distinct types, namely the hepatic-, intestinal- and cardiac-type. They form 14-15 kDa proteins and are thought to participate in the uptake, intracellular metabolism and/or transport of long-chain fatty acids. Also, they may be responsible in the modulation of cell growth and proliferation.

FeedBack
Abcepta welcomes feedback from its customers.

If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abcepta.com.

$ 370.00
Cat# ABO12628
Size:
Quantity:
Availability: 3-5 days
Bulk Size

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthersMexico
Abcepta, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Terms & Conditions
"