Anti-P GlycoProtein Antibody
- SPECIFICATION
- CITATIONS
- PROTOCOLS
- BACKGROUND

Application
| IHC-P, IHC-F |
|---|---|
| Primary Accession | P08183 |
| Host | Rabbit |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Format | Lyophilized |
| Description | Rabbit IgG polyclonal antibody for Multidrug resistance protein 1(ABCB1) detection. Tested with IHC-P, IHC-F in Human;Mouse;Rat. |
| Reconstitution | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
| Gene ID | 5243 |
|---|---|
| Other Names | Multidrug resistance protein 1, 3.6.3.44, ATP-binding cassette sub-family B member 1, P-glycoprotein 1, CD243, ABCB1, MDR1, PGY1 |
| Calculated MW | 141479 MW KDa |
| Application Details | Immunohistochemistry(Frozen Section), 0.5-1 µg/ml, Mouse, Rat, - Immunohistochemistry(Paraffin-embedded Section), 0.5-1 µg/ml, Human, Mouse, Rat, By Heat |
| Subcellular Localization | Cell membrane ; Multi-pass membrane protein . |
| Tissue Specificity | Expressed in liver, kidney, small intestine and brain. |
| Protein Name | Multidrug resistance protein 1 |
| Contents | Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg Thimerosal, 0.05mg NaN3. |
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human P Glycoprotein(621-650aa IYFKLVTMQTAGNEVELENAADESKSEIDA), different from the related rat sequence by twelve amino acids. |
| Purification | Immunogen affinity purified. |
| Cross Reactivity | No cross reactivity with other proteins |
| Storage | At -20˚C for one year. After r˚Constitution, at 4˚C for one month. It˚Can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing. |
| Sequence Similarities | Belongs to the ABC transporter superfamily. ABCB family. Multidrug resistance exporter (TC 3.A.1.201) subfamily. |
| Name | ABCB1 (HGNC:40) |
|---|---|
| Synonyms | MDR1, PGY1 |
| Function | Translocates drugs and phospholipids across the membrane (PubMed:2897240, PubMed:35970996, PubMed:8898203, PubMed:9038218, PubMed:35507548). Catalyzes the flop of phospholipids from the cytoplasmic to the exoplasmic leaflet of the apical membrane. Participates mainly to the flop of phosphatidylcholine, phosphatidylethanolamine, beta-D-glucosylceramides and sphingomyelins (PubMed:8898203). Energy-dependent efflux pump responsible for decreased drug accumulation in multidrug-resistant cells (PubMed:2897240, PubMed:35970996, PubMed:9038218). |
| Cellular Location | Cell membrane; Multi-pass membrane protein {ECO:0000255|PROSITE-ProRule:PRU00441} Apical cell membrane. Cytoplasm Note=ABCB1 localization is influenced by C1orf115 expression levels (plasma membrane versus cytoplasm). Localized to the apical membrane of enterocytes (PubMed:28408210). |
| Tissue Location | Expressed in small intestine (PubMed:28408210). Expressed in liver, kidney and brain. |

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
info@abcepta.com, and receive a free "I Love Antibodies" mug.
Provided below are standard protocols that you may find useful for product applications.
Background
P-GP, also called ABCB1 or PGY1, is a glycoprotein that in humans is encoded by the ABCB1 gene. It is mapped to 7q21.12. P-GP is a well-characterized ABC-transporter (which transports a wide variety of substrates across extra- and intracellular membranes) of the MDR/TAP subfamily. It is an important protein of the cell membrane that pumps many foreign substances out of cells. More formally, it is an ATP-dependent drug efflux pump with broad substrate specificity. P-GP is an ATP-dependent drug efflux pump forxenobiotic compounds with broad substrate specificity. It is responsible for decreased drug accumulation in multidrug-resistant cells and often mediates the development of resistance to anticancer drugs. This protein also functions as a transporter in the blood–brain barrier.
If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.
If you have any additional inquiries please email technical services at tech@abcepta.com.





Foundational characteristics of cancer include proliferation, angiogenesis, migration, evasion of apoptosis, and cellular immortality. Find key markers for these cellular processes and antibodies to detect them.
The SUMOplot™ Analysis Program predicts and scores sumoylation sites in your protein. SUMOylation is a post-translational modification involved in various cellular processes, such as nuclear-cytosolic transport, transcriptional regulation, apoptosis, protein stability, response to stress, and progression through the cell cycle.
The Autophagy Receptor Motif Plotter predicts and scores autophagy receptor binding sites in your protein. Identifying proteins connected to this pathway is critical to understanding the role of autophagy in physiological as well as pathological processes such as development, differentiation, neurodegenerative diseases, stress, infection, and cancer.






