Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Primary Antibodies   >   Signal Transduction   >   SPAG6 Antibody (C-term)   

SPAG6 Antibody (C-term)

Affinity Purified Rabbit Polyclonal Antibody (Pab)

     
  • WB - SPAG6 Antibody (C-term) AP20398b
    SPAG6 Antibody (C-term) (Cat. #AP20398b) western blot analysis in MDA-MB453 cell line lysates (35ug/lane).This demonstrates the SPAG6 antibody detected the SPAG6 protein (arrow).
  • SPECIFICATION
  • CITATIONS: 1
  • PROTOCOLS
  • BACKGROUND
Product Information
Application
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • E=ELISA
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
WB, E
Primary Accession O75602
Other Accession Q9JLI7
Reactivity Human
Predicted Mouse
Host Rabbit
Clonality Polyclonal
Isotype Rabbit Ig
Antigen Region 422-448 aa
Additional Information
Other Names Sperm-associated antigen 6, Protein PF16 homolog, Repro-SA-1, Sperm flagellar protein, SPAG6, PF16
Target/Specificity This SPAG6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 422-448 amino acids from the C-terminal region of human SPAG6.
Dilution WB~~1:1000
Format Purified polyclonal antibody supplied in PBS with 0.09% (W/V) sodium azide. This antibody is purified through a protein A column, followed by peptide affinity purification.
StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
PrecautionsSPAG6 Antibody (C-term) is for research use only and not for use in diagnostic or therapeutic procedures.
Protein Information
Name SPAG6
Synonyms PF16
Function Important for structural integrity of the central apparatus in the sperm tail and for flagellar motility.
Cellular Location Cytoplasm, cytoskeleton. Cell projection, cilium, flagellum. Note=Associated with microtubules Detected on the sperm flagellum
Tissue Location Highly expressed in testis. EMBL; AF079363; AAC32590.1; -; mRNA EMBL; AL080136; CAB45730.1; -; mRNA EMBL; CR533552; CAG38583.1; -; mRNA EMBL; AK289903; BAF82592.1; -; mRNA EMBL; AK302194; BAG63556.1; -; mRNA EMBL; AL158211; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; AL513128; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; CH471072; EAW86146.1; -; Genomic_DNA EMBL; BC030585; AAH30585.1; -; mRNA CCDS; CCDS58071.1; -. [O75602-5] CCDS; CCDS7139.1; -. [O75602-1] CCDS; CCDS7140.1; -. [O75602-2] PIR; T12521; T12521 RefSeq; NP_001240783.1; NM_001253854.1. [O75602-5] RefSeq; NP_001240784.1; NM_001253855.1 RefSeq; NP_036575.1; NM_012443.3. [O75602-1] RefSeq; NP_758442.1; NM_172242.2. [O75602-2] SMR; O75602; - BioGRID; 114945; 2 IntAct; O75602; 1 STRING; 9606.ENSP00000365811; - iPTMnet; O75602; - PhosphoSitePlus; O75602; - BioMuta; SPAG6; - MassIVE; O75602; - PaxDb; O75602; - PeptideAtlas; O75602; - PRIDE; O75602; - ProteomicsDB; 50107; -. [O75602-1] ProteomicsDB; 50108; -. [O75602-2] ProteomicsDB; 50109; -. [O75602-3] ProteomicsDB; 50110; -. [O75602-4] ProteomicsDB; 5482; - Antibodypedia; 25669; 151 antibodies DNASU; 9576; - Ensembl; ENST00000313311; ENSP00000323599; ENSG00000077327. [O75602-2] Ensembl; ENST00000376624; ENSP00000365811; ENSG00000077327. [O75602-1] Ensembl; ENST00000538630; ENSP00000441325; ENSG00000077327. [O75602-5] GeneID; 9576; - KEGG; hsa:9576; - UCSC; uc001iri.4; human. [O75602-1] CTD; 9576; - DisGeNET; 9576; - EuPathDB; HostDB:ENSG00000077327.15; - GeneCards; SPAG6; - HGNC; HGNC:11215; SPAG6 HPA; ENSG00000077327; Tissue enhanced (brain, fallopian tube, testis) MIM; 605730; gene neXtProt; NX_O75602; - OpenTargets; ENSG00000077327; - PharmGKB; PA36051; - eggNOG; KOG0166; Eukaryota GeneTree; ENSGT00900000141099; - HOGENOM; CLU_022627_1_0_1; - InParanoid; O75602; - OMA; YVRKNVA; - PhylomeDB; O75602; - TreeFam; TF328894; - PathwayCommons; O75602; - SignaLink; O75602; - BioGRID-ORCS; 9576; 5 hits in 869 CRISPR screens ChiTaRS; SPAG6; human GeneWiki; SPAG6; - GenomeRNAi; 9576; - Pharos; O75602; Tbio PRO; PR:O75602; - Proteomes; UP000005640; Chromosome 10 RNAct; O75602; protein Bgee; ENSG00000077327; Expressed in bronchial epithelial cell and 117 other tissues ExpressionAtlas; O75602; baseline and differential Genevisible; O75602; HS GO; GO:0005930; C:axoneme; TAS:ProtInc GO; GO:0005874; C:microtubule; IEA:UniProtKB-KW GO; GO:0015630; C:microtubule cytoskeleton; IDA:LIFEdb GO; GO:0005634; C:nucleus; HDA:UniProtKB GO; GO:0097228; C:sperm principal piece; IDA:UniProtKB GO; GO:0030030; P:cell projection organization; IEA:UniProtKB-KW GO; GO:0007286; P:spermatid development; TAS:ProtInc Gene3D; 1.25.10.10; -; 2 InterPro; IPR011989; ARM-like InterPro; IPR016024; ARM-type_fold InterPro; IPR000225; Armadillo Pfam; PF00514; Arm; 4 SMART; SM00185; ARM; 7 SUPFAM; SSF48371; SSF48371; 1 2: Evidence at transcript level; Alternative splicing; Cell projection; Cilium; Cilium biogenesis/degradation; Cytoplasm; Cytoskeleton; Flagellum; Microtubule; Polymorphism; Reference proteome; Repeat CHAIN 1..509 /note="Sperm-associated antigen 6" /id="PRO_0000072095" REPEAT 31..70 /note="ARM 1" REPEAT 73..112 /note="ARM 2" REPEAT 115..154 /note="ARM 3" REPEAT 157..196 /note="ARM 4" REPEAT 199..238 /note="ARM 5" REPEAT 241..280 /note="ARM 6" REPEAT 325..365 /note="ARM 7" REPEAT 368..409 /note="ARM 8" VAR_SEQ 1..39 /note="MSQRQVLQVFEQYQKARTQFVQMVAELATRPQNIETLQN -> MHSLTMDLW IPNGQ (in isoform 5)" /evidence="ECO:0000303|PubMed:14702039" /id="VSP_045337" VAR_SEQ 41 /note="G -> GEPGARTPVAPRALSPRRLRPAALPVELLGSRSVGTGVRKSIHSFQR VFGGQAERVKLPDGCGRCALSLFPSSLHTG (in isoform 3)" /evidence="ECO:0000305" /id="VSP_013442" VAR_SEQ 97..335 /note="Missing (in isoform 4)" /evidence="ECO:0000305" /id="VSP_013443" VAR_SEQ 441..458 /note="PHDSKARRLFVTSGGLKK -> FPWIFRYTSAEGGQLSTT (in isoform 2)" /evidence="ECO:0000303|PubMed:15489334" /id="VSP_013444" VAR_SEQ 459..509 /note="Missing (in isoform 2)" /evidence="ECO:0000303|PubMed:15489334" /id="VSP_013445" VARIANT 106 /note="V -> L (in a breast cancer sample; somatic mutation)" /evidence="ECO:0000269|PubMed:16959974" /id="VAR_035659" VARIANT 216 /note="Q -> R (in dbSNP:rs7074847)" /id="VAR_024282" CONFLICT 60 /note="T -> I (in Ref. 7; AAH30585)" /evidence="ECO:0000305" CONFLICT 161 /note="Q -> R (in Ref. 3; CAG38583)" /evidence="ECO:0000305" CONFLICT 185 /note="R -> G (in Ref. 7; AAH30585)" /evidence="ECO:0000305" CONFLICT 195 /note="A -> V (in Ref. 7; AAH30585)" /evidence="ECO:0000305" SEQUENCE 509 AA; 55476 MW; 03D868E31D3883E1 CRC64; MSQRQVLQVF EQYQKARTQF VQMVAELATR PQNIETLQNA GVMSLLRTLL LDVVPTIQQT AALALGRLAN YNDDLAEAVV KCDILPQLVY SLAEQNRFYK KAAAFVLRAV GKHSPQLAQA IVDCGALDTL VICLEDFDPG VKEAAAWALR YIARHNAELS QAVVDAGAVP LLVLCIQEPE IALKRIAASA LSDIAKHSPE LAQTVVDAGA VAHLAQMILN PDAKLKHQIL SALSQVSKHS VDLAEMVVEA EIFPVVLTCL KDKDEYVKKN ASTLIREIAK HTPELSQLVV NAGGVAAVID CIGSCKGNTR LPGIMMLGYV AAHSENLAMA VIISKGVPQL SVCLSEEPED HIKAAAAWAL GQIGRHTPEH ARAVAVTNTL PVLLSLYMST ESSEDLQVKS KKAIKNILQK CTYLPALEPF LYDAPPNILK HVVGQFSKVL PHDSKARRLF VTSGGLKKVQ EIKAEPGSLL QEYINSINSC YPEEIVRYYS PGYSDTLLQR VDSYQPLNN
Research Areas
Citations ( 0 )

Background

Important for structural integrity of the central apparatus in the sperm tail and for flagellar motility (By similarity).

FeedBack
Abcepta welcomes feedback from its customers.

If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abcepta.com.

$ 162.50
$ 54.50
Cat# AP20398b
Size:
Quantity:
Availability: In Stock
Bulk Size

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abcepta, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900
Cedarlane Labs
+1 (800) 721-1644
+1 (336) 513-5138

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Terms & Conditions
"