Foundational characteristics of cancer include proliferation, angiogenesis, migration, evasion of apoptosis, and cellular immortality. Find key markers for these cellular processes and antibodies to detect them.
The SUMOplot™ Analysis Program predicts and scores sumoylation sites in your protein. SUMOylation is a post-translational modification involved in various cellular processes, such as nuclear-cytosolic transport, transcriptional regulation, apoptosis, protein stability, response to stress, and progression through the cell cycle.
The Autophagy Receptor Motif Plotter predicts and scores autophagy receptor binding sites in your protein. Identifying proteins connected to this pathway is critical to understanding the role of autophagy in physiological as well as pathological processes such as development, differentiation, neurodegenerative diseases, stress, infection, and cancer.
SUR1 and SUR2B Antibody
SUR1/SUR2B Antibody, Clone S323A-31
- SPECIFICATION
- CITATIONS
- PROTOCOLS
- BACKGROUND
Application 
| WB, ICC |
|---|---|
| Primary Accession | Q63563 |
| Other Accession | NP_037172.2 |
| Host | Mouse |
| Isotype | IgG1 |
| Reactivity | Mouse, Rat |
| Clonality | Monoclonal |
| Description | Mouse Anti-Rat SUR1 and SUR2B Monoclonal IgG1 |
| Target/Specificity | Detects ~175kDa and smaller fragments likely due to proteolytic cleavage. |
| Other Names | ABC36 Antibody, Abcc8 Antibody, ABCC8_HUMAN Antibody, ATP binding cassette sub family C (CFTR/MRP) member 8 Antibody, ATP binding cassette transporter sub family C member 8 (1) Antibody, ATP-binding cassette sub-family C member 8 Antibody, HHF1 Antibody, HI Antibody, HRINS Antibody, MRP8 Antibody, PHHI Antibody, Sulfonylurea receptor (hyperinsulinemia) Antibody, Sulfonylurea receptor 1 Antibody, SUR Antibody, SUR1 Antibody, SUR1delta2 Antibody, TNDM2 Antibody, ABC37 Antibody, abcC9 Antibody, ABCC9_HUMAN Antibody, AI414027 Antibody, AI449286 Antibody, ATFB12 Antibody, ATP-binding cassette sub-family C member 9 Antibody, ATP-binding cassette transporter sub-family C member 9 Antibody, ATP-binding cassette Antibody, sub-family C (CFTR/MRP) Antibody, member 9 Antibody, CANTU Antibody, CMD1O Antibody, FLJ36852 Antibody, Sulfonylurea receptor 2 Antibody, Sulfonylurea-binding protein 2 Antibody, SUR2 Antibody, SUR2A Antibody, SUR2B Antibody |
| Clone Names | S323A-31 |
| Immunogen | Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B |
| Purification | Protein G Purified |
| Storage | -20ºC |
| Storage Buffer | PBS pH7.4, 50% glycerol, 0.09% sodium azide |
| Shipping Temperature | Blue Ice or 4ºC |
| Certificate of Analysis | 1 µg/ml of SMC-432 was sufficient for detection of SUR1 and SUR2B in 20 µg of mouse brain membrane lysate and assayed by colorimetric immunoblot analysis using goat anti-mouse IgG:HRP as the secondary antibody. |
| Cellular Localization | Membrane |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
info@abcepta.com, and receive a free "I Love Antibodies" mug.
Provided below are standard protocols that you may find useful for product applications.
Background
Sulfonylurea receptors (SUR) are membrane proteins which are the molecular targets of the sulfonylurea class of anti-diabetic drugs whose mechanism of action is to promote insulin release from pancreatic beta cells. More specifically, SUR proteins are subunits of the inward-rectifier potassium ion channels Kir6.x (6.1 and 6.2) (1). The association of four Kir6.x and four SUR subunits form an ion conducting channel commonly referred to as the KATP channel. The primary function of the sulfonylurea receptor is to sense intracellular levels of the nucleotides ATP and ADP and in response facilitate the open or closing its associated Kir6.x potassium channel. Hence the KATP channel monitors the energy balance within the cell (2).
References
1. Campbell J.D., Sansom M.S., Ashcroft F.M. (2003) EMBO Resp. 4(11): 1038-1042.
2. Nichols C.G. (2006) Nature. 440 (7083): 470-476.
If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.
If you have any additional inquiries please email technical services at tech@abcepta.com.
Ordering Information
Shipping Information
