Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Peptides   >   Blocking Peptides   >   UBASH3A Antibody (Center) Blocking Peptide   

UBASH3A Antibody (Center) Blocking Peptide

Synthetic peptide

     
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
Product Information
Primary Accession P57075
Clone Names 90713226
Additional Information
Other Names Ubiquitin-associated and SH3 domain-containing protein A, Cbl-interacting protein 4, CLIP4, Suppressor of T-cell receptor signaling 2, STS-2, T-cell ubiquitin ligand 1, TULA-1, UBASH3A, STS2
Format Peptides are lyophilized in a solid powder format. Peptides can be reconstituted in solution using the appropriate buffer as needed.
StorageMaintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.
PrecautionsThis product is for research use only. Not for use in diagnostic or therapeutic procedures.
Protein Information
Name UBASH3A
Synonyms STS2
Function Interferes with CBL-mediated down-regulation and degradation of receptor-type tyrosine kinases. Promotes accumulation of activated target receptors, such as T-cell receptors, EGFR and PDGFRB, on the cell surface. Exhibits negligigle protein tyrosine phosphatase activity at neutral pH. May act as a dominant-negative regulator of UBASH3B- dependent dephosphorylation. May inhibit dynamin-dependent endocytic pathways by functionally sequestering dynamin via its SH3 domain.
Cellular Location Cytoplasm. Nucleus.
Tissue Location Highest expression of UBASH3A in tissues belonging to the immune system, including spleen, peripheral blood leukocytes, thymus and bone marrow. EMBL; AJ277750; CAB91543.1; -; mRNA EMBL; AF520809; AAP80731.1; -; mRNA EMBL; AF521702; AAP80738.1; -; mRNA EMBL; AP001746; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; CH471079; EAX09560.1; -; Genomic_DNA EMBL; BC069357; AAH69357.1; -; mRNA EMBL; BC069483; AAH69483.1; -; mRNA EMBL; BC069511; AAH69511.1; -; mRNA EMBL; BC069577; -; NOT_ANNOTATED_CDS; mRNA CCDS; CCDS13687.1; -. [P57075-1] CCDS; CCDS33566.1; -. [P57075-2] CCDS; CCDS58791.1; -. [P57075-3] RefSeq; NP_001001895.1; NM_001001895.2. [P57075-2] RefSeq; NP_001230396.1; NM_001243467.1. [P57075-3] RefSeq; NP_061834.1; NM_018961.3. [P57075-1] PDB; 2CRN; NMR; -; A=20-70 PDB; 5WDI; X-ray; 2.43 A; A/B=394-658 PDBsum; 2CRN; - PDBsum; 5WDI; - SMR; P57075; - BioGRID; 119748; 91 IntAct; P57075; 79 MINT; P57075; - STRING; 9606.ENSP00000317327; - DEPOD; UBASH3A; - iPTMnet; P57075; - PhosphoSitePlus; P57075; - BioMuta; UBASH3A; - DMDM; 10720330; - jPOST; P57075; - MassIVE; P57075; - MaxQB; P57075; - PaxDb; P57075; - PeptideAtlas; P57075; - PRIDE; P57075; - ProteomicsDB; 33914; - ProteomicsDB; 56982; -. [P57075-1] ProteomicsDB; 56983; -. [P57075-2] Antibodypedia; 23818; 286 antibodies Ensembl; ENST00000291535; ENSP00000291535; ENSG00000160185. [P57075-2] Ensembl; ENST00000319294; ENSP00000317327; ENSG00000160185. [P57075-1] Ensembl; ENST00000398367; ENSP00000381408; ENSG00000160185. [P57075-3] GeneID; 53347; - KEGG; hsa:53347; - UCSC; uc002zbe.4; human. [P57075-1] CTD; 53347; - DisGeNET; 53347; - EuPathDB; HostDB:ENSG00000160185.14; - GeneCards; UBASH3A; - HGNC; HGNC:12462; UBASH3A HPA; ENSG00000160185; Group enriched (blood, lymphoid tissue) MIM; 605736; gene neXtProt; NX_P57075; - OpenTargets; ENSG00000160185; - PharmGKB; PA37112; - eggNOG; KOG3734; Eukaryota GeneTree; ENSGT00940000160841; - HOGENOM; CLU_016516_0_0_1; - InParanoid; P57075; - KO; K18993; - OMA; KYCSVKP; - OrthoDB; 243749at2759; - PhylomeDB; P57075; - TreeFam; TF313334; - PathwayCommons; P57075; - SignaLink; P57075; - BioGRID-ORCS; 53347; 13 hits in 878 CRISPR screens ChiTaRS; UBASH3A; human EvolutionaryTrace; P57075; - GeneWiki; UBASH3A; - GenomeRNAi; 53347; - Pharos; P57075; Tbio PRO; PR:P57075; - Proteomes; UP000005640; Chromosome 21 RNAct; P57075; protein Bgee; ENSG00000160185; Expressed in granulocyte and 100 other tissues ExpressionAtlas; P57075; baseline and differential Genevisible; P57075; HS GO; GO:0005737; C:cytoplasm; IBA:GO_Central GO; GO:0005829; C:cytosol; HDA:UniProtKB GO; GO:0070062; C:extracellular exosome; HDA:UniProtKB GO; GO:0005794; C:Golgi apparatus; IDA:HPA GO; GO:0005654; C:nucleoplasm; IDA:HPA GO; GO:0050860; P:negative regulation of T cell receptor signaling pathway; IBA:GO_Central GO; GO:0001817; P:regulation of cytokine production; IEA:Ensembl CDD; cd07067; HP_PGM_like; 1 CDD; cd11937; SH3_UBASH3A; 1 Gene3D; 3.40.50.1240; -; 1 InterPro; IPR013078; His_Pase_superF_clade-1 InterPro; IPR029033; His_PPase_superfam InterPro; IPR036028; SH3-like_dom_sf InterPro; IPR001452; SH3_domain InterPro; IPR015940; UBA InterPro; IPR009060; UBA-like_sf InterPro; IPR035634; UBASH3A_SH3 Pfam; PF00300; His_Phos_1; 1 Pfam; PF14604; SH3_9; 1 SMART; SM00326; SH3; 1 SUPFAM; SSF46934; SSF46934; 1 SUPFAM; SSF50044; SSF50044; 1 SUPFAM; SSF53254; SSF53254; 1 PROSITE; PS50002; SH3; 1 PROSITE; PS50030; UBA; 1 1: Evidence at protein level; 3D-structure; Alternative splicing; Cytoplasm; Nucleus; Polymorphism; Reference proteome; SH3 domain CHAIN 1..661 /note="Ubiquitin-associated and SH3 domain-containing protein A" /id="PRO_0000210994" DOMAIN 15..60 /note="UBA" /evidence="ECO:0000255|PROSITE-ProRule:PRU00212" DOMAIN 276..341 /note="SH3" /evidence="ECO:0000255|PROSITE-ProRule:PRU00192" REGION 395..661 /note="Phosphatase-like" VAR_SEQ 185..223 /note="GTSVSRFWIFSQVPGHGPNLRLSNLTRASFVSHYILQKY -> D (in isoform 2 and isoform 3)" /evidence="ECO:0000303|PubMed:11281453, ECO:0000303|PubMed:15107835, ECO:0000303|PubMed:15489334" /id="VSP_006703" VAR_SEQ 545..564 /note="PAFPLSALMPAESYQEYMDR -> SLPWACASVKKIKRKENGSW (in isoform 3)" /evidence="ECO:0000303|PubMed:15489334" /id="VSP_045549" VAR_SEQ 565..661 /note="Missing (in isoform 3)" /evidence="ECO:0000303|PubMed:15489334" /id="VSP_045550" VARIANT 18 /note="S -> G (in dbSNP:rs2277798)" /evidence="ECO:0000269|PubMed:15489334" /id="VAR_026971" VARIANT 28 /note="L -> F (in dbSNP:rs2277800)" /evidence="ECO:0000269|PubMed:15489334" /id="VAR_026972" VARIANT 286 /note="Q -> R (in dbSNP:rs775952011)" /id="VAR_026973" VARIANT 324 /note="R -> L (in dbSNP:rs13048049)" /id="VAR_061921" VARIANT 324 /note="R -> Q (in dbSNP:rs13048049)" /id="VAR_061922" VARIANT 466 /note="D -> E (in dbSNP:rs17114930)" /id="VAR_052675" MUTAGEN 317 /note="W->A: Loss of interaction with CBL." /evidence="ECO:0000269|PubMed:15159412, ECO:0000269|PubMed:17382318" MUTAGEN 317 /note="W->L: Abolishes binding to dynamin." /evidence="ECO:0000269|PubMed:15159412, ECO:0000269|PubMed:17382318" CONFLICT 64 /note="P -> H (in Ref. 5; AAH69511)" /evidence="ECO:0000305" CONFLICT 129 /note="E -> K (in Ref. 5; BC069577)" /evidence="ECO:0000305" CONFLICT 229 /note="C -> Y (in Ref. 5; AAH69511)" /evidence="ECO:0000305" CONFLICT 283 /note="A -> V (in Ref. 5; AAH69483)" /evidence="ECO:0000305" CONFLICT 393 /note="V -> I (in Ref. 5; AAH69511)" /evidence="ECO:0000305" CONFLICT 651 /note="A -> V (in Ref. 5; AAH69511)" /evidence="ECO:0000305" HELIX 25..30 /evidence="ECO:0000244|PDB:2CRN" HELIX 35..45 /evidence="ECO:0000244|PDB:2CRN" HELIX 50..60 /evidence="ECO:0000244|PDB:2CRN" STRAND 61..63 /evidence="ECO:0000244|PDB:2CRN" STRAND 397..402 /evidence="ECO:0000244|PDB:5WDI" HELIX 407..411 /evidence="ECO:0000244|PDB:5WDI" HELIX 415..418 /evidence="ECO:0000244|PDB:5WDI" HELIX 445..447 /evidence="ECO:0000244|PDB:5WDI" HELIX 455..471 /evidence="ECO:0000244|PDB:5WDI" STRAND 475..480 /evidence="ECO:0000244|PDB:5WDI" HELIX 484..497 /evidence="ECO:0000244|PDB:5WDI" TURN 500..502 /evidence="ECO:0000244|PDB:5WDI" STRAND 505..507 /evidence="ECO:0000244|PDB:5WDI" HELIX 509..511 /evidence="ECO:0000244|PDB:5WDI" HELIX 515..517 /evidence="ECO:0000244|PDB:5WDI" HELIX 529..534 /evidence="ECO:0000244|PDB:5WDI" HELIX 549..551 /evidence="ECO:0000244|PDB:5WDI" HELIX 558..574 /evidence="ECO:0000244|PDB:5WDI" STRAND 581..587 /evidence="ECO:0000244|PDB:5WDI" HELIX 591..594 /evidence="ECO:0000244|PDB:5WDI" HELIX 597..600 /evidence="ECO:0000244|PDB:5WDI" HELIX 607..615 /evidence="ECO:0000244|PDB:5WDI" STRAND 622..628 /evidence="ECO:0000244|PDB:5WDI" TURN 629..632 /evidence="ECO:0000244|PDB:5WDI" STRAND 633..637 /evidence="ECO:0000244|PDB:5WDI" HELIX 654..657 /evidence="ECO:0000244|PDB:5WDI" SEQUENCE 661 AA; 74123 MW; 60DA2E0B8CE4ABFC CRC64; MAAGETQLYA KVSNKLKSRS SPSLLEPLLA MGFPVHTALK ALAATGRKTA EEALAWLHDH CNDPSLDDPI PQEYALFLCP TGPLLEKLQE FWRESKRQCA KNRAHEVFPH VTLCDFFTCE DQKVECLYEA LKRAGDRLLG SFPTAVPLAL HSSISYLGFF VSGSPADVIR EFAMTFATEA SLLAGTSVSR FWIFSQVPGH GPNLRLSNLT RASFVSHYIL QKYCSVKPCT KQLHLTLAHK FYPHHQRTLE QLARAIPLGH SCQWTAALYS RDMRFVHYQT LRALFQYKPQ NVDELTLSPG DYIFVDPTQQ DEASEGWVIG ISQRTGCRGF LPENYTDRAS ESDTWVKHRM YTFSLATDLN SRKDGEASSR CSGEFLPQTA RSLSSLQALQ ATVARKSVLV VRHGERVDQI FGKAWLQQCS TPDGKYYRPD LNFPCSLPRR SRGIKDFEND PPLSSCGIFQ SRIAGDALLD SGIRISSVFA SPALRCVQTA KLILEELKLE KKIKIRVEPG IFEWTKWEAG KTTPTLMSLE ELKEANFNID TDYRPAFPLS ALMPAESYQE YMDRCTASMV QIVNTCPQDT GVILIVSHGS TLDSCTRPLL GLPPRECGDF AQLVRKIPSL GMCFCEENKE EGKWELVNPP VKTLTHGANA AFNWRNWISG N
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abcepta antibody to
info@abcepta.com, and receive a free "I Love Antibodies" mug.

Background

UBASH3A interferes with CBL-mediated down-regulation and degradation of receptor-type tyrosine kinases. Promotes accumulation of activated target receptors, such as T-cell receptors, EGFR and PDGFRB, on the cell surface.

References

Hinks, A., et al. Ann. Rheum. Dis. (2010) In press :Stahl, E.A., et al. Nat. Genet. 42(6):508-514(2010)Jin, Y., et al. N. Engl. J. Med. 362(18):1686-1697(2010)Barrett, J.C., et al. Nat. Genet. 41(6):703-707(2009)Smyth, D.J., et al. N. Engl. J. Med. 359(26):2767-2777(2008)

FeedBack
Abcepta welcomes feedback from its customers.

If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abcepta.com.

$ 277.78
Cat# BP19175c
Size:
Quantity:
Availability: 2 weeks
Bulk Size

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abcepta, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900
Cedarlane Labs
+1 (800) 721-1644
+1 (336) 513-5138

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Terms & Conditions
"