Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Peptides   >   Blocking Peptides   >   PLP2 Blocking Peptide (C-term)   

PLP2 Blocking Peptide (C-term)

Synthetic peptide

     
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
Product Information
Primary Accession Q04941
Additional Information
Other Names Proteolipid protein 2, Differentiation-dependent protein A4, Intestinal membrane A4 protein, PLP2, A4
Target/Specificity The synthetic peptide sequence is selected from aa 133-146 of HUMAN PLP2
Format Peptides are lyophilized in a solid powder format. Peptides can be reconstituted in solution using the appropriate buffer as needed.
StorageMaintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.
PrecautionsThis product is for research use only. Not for use in diagnostic or therapeutic procedures.
Protein Information
Name PLP2
Synonyms A4
Function May play a role in cell differentiation in the intestinal epithelium.
Cellular Location Membrane; Multi-pass membrane protein.
Tissue Location Enriched in colonic mucosa. The expression of A4 follows a gradient along the crypto-villus axis with the most abundant message occurring in the lower half of the crypt EMBL; L09604; AAA35499.1; -; mRNA EMBL; U93305; AAB92356.1; -; Genomic_DNA EMBL; DB102321; -; NOT_ANNOTATED_CDS; mRNA EMBL; AF196779; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; BC109066; AAI09067.1; -; mRNA CCDS; CCDS14319.1; -. [Q04941-1] PIR; S32567; S32567 RefSeq; NP_002659.1; NM_002668.2. [Q04941-1] BioGRID; 111369; 33 IntAct; Q04941; 71 MINT; Q04941; - STRING; 9606.ENSP00000365505; - TCDB; 1.A.64.5.2; the plasmolipin (plasmolipin) family GlyGen; Q04941; 2 sites iPTMnet; Q04941; - PhosphoSitePlus; Q04941; - SwissPalm; Q04941; - BioMuta; PLP2; - DMDM; 416563; - EPD; Q04941; - jPOST; Q04941; - MassIVE; Q04941; - MaxQB; Q04941; - PaxDb; Q04941; - PeptideAtlas; Q04941; - PRIDE; Q04941; - ProteomicsDB; 58301; -. [Q04941-1] ProteomicsDB; 58302; -. [Q04941-2] TopDownProteomics; Q04941-1; -. [Q04941-1] Antibodypedia; 12063; 59 antibodies Ensembl; ENST00000376322; ENSP00000365500; ENSG00000102007. [Q04941-2] Ensembl; ENST00000376327; ENSP00000365505; ENSG00000102007. [Q04941-1] GeneID; 5355; - KEGG; hsa:5355; - UCSC; uc004dmx.4; human. [Q04941-1] CTD; 5355; - DisGeNET; 5355; - EuPathDB; HostDB:ENSG00000102007.10; - GeneCards; PLP2; - HGNC; HGNC:9087; PLP2 HPA; ENSG00000102007; Low tissue specificity MIM; 300112; gene neXtProt; NX_Q04941; - OpenTargets; ENSG00000102007; - PharmGKB; PA33415; - eggNOG; KOG4788; Eukaryota GeneTree; ENSGT00940000158528; - HOGENOM; CLU_108546_4_0_1; - InParanoid; Q04941; - OMA; KIQFINW; - PhylomeDB; Q04941; - TreeFam; TF317387; - PathwayCommons; Q04941; - BioGRID-ORCS; 5355; 3 hits in 498 CRISPR screens ChiTaRS; PLP2; human GeneWiki; PLP2; - GenomeRNAi; 5355; - Pharos; Q04941; Tbio PRO; PR:Q04941; - Proteomes; UP000005640; Chromosome X RNAct; Q04941; protein Bgee; ENSG00000102007; Expressed in blood and 225 other tissues ExpressionAtlas; Q04941; baseline and differential Genevisible; Q04941; HS GO; GO:0005783; C:endoplasmic reticulum; TAS:ProtInc GO; GO:0005789; C:endoplasmic reticulum membrane; TAS:ProtInc GO; GO:0016021; C:integral component of membrane; IBA:GO_Central GO; GO:0016020; C:membrane; TAS:ProtInc GO; GO:0005886; C:plasma membrane; IDA:UniProtKB GO; GO:0019956; F:chemokine binding; IPI:UniProtKB GO; GO:0015075; F:ion transmembrane transporter activity; TAS:ProtInc GO; GO:0006935; P:chemotaxis; NAS:UniProtKB GO; GO:0019221; P:cytokine-mediated signaling pathway; NAS:UniProtKB GO; GO:0006811; P:ion transport; TAS:ProtInc InterPro; IPR008253; Marvel Pfam; PF01284; MARVEL; 1 PROSITE; PS51225; MARVEL; 1 1: Evidence at protein level; Alternative splicing; Glycoprotein; Membrane; Polymorphism; Reference proteome; Transmembrane; Transmembrane helix CHAIN 1..152 /note="Proteolipid protein 2" /id="PRO_0000156819" TRANSMEM 25..45 /note="Helical" /evidence="ECO:0000255" TRANSMEM 48..68 /note="Helical" /evidence="ECO:0000255" TRANSMEM 85..105 /note="Helical" /evidence="ECO:0000255" TRANSMEM 112..132 /note="Helical" /evidence="ECO:0000255" DOMAIN 19..137 /note="MARVEL" /evidence="ECO:0000255|PROSITE-ProRule:PRU00581" CARBOHYD 18 /note="N-linked (GlcNAc...) asparagine" /evidence="ECO:0000255" CARBOHYD 108 /note="N-linked (GlcNAc...) asparagine" /evidence="ECO:0000255" VAR_SEQ 117..152 /note="LGLIATCLFGYDAYVTFPVRQPRHTAAPTDPADGPV -> KAMGAALKHRAK GLRSQGPFLPLLLAEIV (in isoform 2)" /evidence="ECO:0000303|PubMed:16344560" /id="VSP_041602" VARIANT 91 /note="A -> S (in dbSNP:rs1802969)" /id="VAR_011924" SEQUENCE 152 AA; 16691 MW; 689378A8C326206C CRC64; MADSERLSAP GCWAACTNFS RTRKGILLFA EIILCLVILI CFSASTPGYS SLSVIEMILA AIFFVVYMCD LHTKIPFINW PWSDFFRTLI AAILYLITSI VVLVERGNHS KIVAGVLGLI ATCLFGYDAY VTFPVRQPRH TAAPTDPADG PV
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abcepta antibody to
info@abcepta.com, and receive a free "I Love Antibodies" mug.

Background

May play a role in cell differentiation in the intestinal epithelium.

References

Oliva M.M.,et al.Arch. Biochem. Biophys. 302:183-192(1993).
Fisher S.E.,et al.Genomics 45:340-347(1997).
Kimura K.,et al.Genome Res. 16:55-65(2006).
Ross M.T.,et al.Nature 434:325-337(2005).
Burkard T.R.,et al.BMC Syst. Biol. 5:17-17(2011).

FeedBack
Abcepta welcomes feedback from its customers.

If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abcepta.com.

$ 277.78
Cat# BP21491b
Size:
Quantity:
Availability: 2 weeks
Bulk Size

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abcepta, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900
Cedarlane Labs
+1 (800) 721-1644
+1 (336) 513-5138

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Terms & Conditions
"