Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Peptides   >   Blocking Peptides   >   BTBD10 Antibody (Center) Blocking Peptide   

BTBD10 Antibody (Center) Blocking Peptide

Synthetic peptide

     
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
Product Information
Primary Accession Q9BSF8
Additional Information
Other Names BTB/POZ domain-containing protein 10, Glucose metabolism-related protein 1, BTBD10, GMRP1 {ECO:0000303|PubMed:21267538}
Format Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 1 mg/ml.
StorageMaintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.
PrecautionsThis product is for research use only. Not for use in diagnostic or therapeutic procedures.
Protein Information
Name BTBD10
Synonyms GMRP1 {ECO:0000303|PubMed:21267538}
Function Plays a major role as an activator of AKT family members by inhibiting PPP2CA-mediated dephosphorylation, thereby keeping AKTs activated. Plays a role in preventing motor neuronal death and accelerating the growth of pancreatic beta cells.
Cellular Location Nucleus. Cytoplasm {ECO:0000250|UniProtKB:Q80X66}. Note=Colocalizes with KCTD20 in filamentous structures. {ECO:0000250|UniProtKB:Q80X66}
Tissue Location Ubiquitously expressed. Highly expressed in adult brain, testis, aorta and small intestine and weakly expressed in the heart, lung, liver, kidney, pancreas, spleen, thymus, prostate, ovary and colon. Down-regulated in glioma. EMBL; AY221959; AAO64360.1; -; mRNA EMBL; AK294259; BAH11714.1; -; mRNA EMBL; AK316163; BAH14534.1; -; mRNA EMBL; AL832981; CAH56329.1; -; mRNA EMBL; AC016884; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; AC021269; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; BC005071; AAH05071.2; -; mRNA CCDS; CCDS73261.1; -. [Q9BSF8-2] CCDS; CCDS7811.1; -. [Q9BSF8-1] RefSeq; NP_001284671.1; NM_001297742.1. [Q9BSF8-2] RefSeq; NP_115696.2; NM_032320.6. [Q9BSF8-1] RefSeq; XP_016873897.1; XM_017018408.1 BioGRID; 124007; 14 IntAct; Q9BSF8; 11 MINT; Q9BSF8; - STRING; 9606.ENSP00000431186; - iPTMnet; Q9BSF8; - PhosphoSitePlus; Q9BSF8; - BioMuta; BTBD10; - DMDM; 74733002; - EPD; Q9BSF8; - jPOST; Q9BSF8; - MassIVE; Q9BSF8; - MaxQB; Q9BSF8; - PaxDb; Q9BSF8; - PeptideAtlas; Q9BSF8; - PRIDE; Q9BSF8; - ProteomicsDB; 6400; - ProteomicsDB; 78886; -. [Q9BSF8-1] Antibodypedia; 24598; 206 antibodies DNASU; 84280; - Ensembl; ENST00000278174; ENSP00000278174; ENSG00000148925. [Q9BSF8-1] Ensembl; ENST00000530907; ENSP00000431186; ENSG00000148925. [Q9BSF8-2] GeneID; 84280; - KEGG; hsa:84280; - UCSC; uc001mkz.4; human. [Q9BSF8-1] CTD; 84280; - DisGeNET; 84280; - EuPathDB; HostDB:ENSG00000148925.10; - GeneCards; BTBD10; - HGNC; HGNC:21445; BTBD10 HPA; ENSG00000148925; Low tissue specificity MIM; 615933; gene neXtProt; NX_Q9BSF8; - OpenTargets; ENSG00000148925; - PharmGKB; PA142672543; - eggNOG; KOG3840; Eukaryota eggNOG; ENOG410XSS5; LUCA GeneTree; ENSGT00390000007975; - InParanoid; Q9BSF8; - KO; K10482; - OMA; WDRKLHN; - OrthoDB; 390051at2759; - PhylomeDB; Q9BSF8; - TreeFam; TF314369; - BioGRID-ORCS; 84280; 2 hits in 786 CRISPR screens ChiTaRS; BTBD10; human GenomeRNAi; 84280; - Pharos; Q9BSF8; Tbio PRO; PR:Q9BSF8; - Proteomes; UP000005640; Chromosome 11 RNAct; Q9BSF8; protein Bgee; ENSG00000148925; Expressed in corpus callosum and 204 other tissues ExpressionAtlas; Q9BSF8; baseline and differential Genevisible; Q9BSF8; HS GO; GO:0005737; C:cytoplasm; ISS:UniProtKB GO; GO:0001650; C:fibrillar center; IDA:HPA GO; GO:0005654; C:nucleoplasm; IDA:HPA GO; GO:1901215; P:negative regulation of neuron death; ISS:UniProtKB GO; GO:0042327; P:positive regulation of phosphorylation; ISS:UniProtKB GO; GO:0044342; P:type B pancreatic cell proliferation; ISS:UniProtKB InterPro; IPR000210; BTB/POZ_dom InterPro; IPR039886; BTBD10/KCTD20 InterPro; IPR039885; BTBD10/KCTD20_BTB/POZ InterPro; IPR011333; SKP1/BTB/POZ_sf PANTHER; PTHR21637; PTHR21637; 1 Pfam; PF16017; BTB_3; 1 SMART; SM00225; BTB; 1 SUPFAM; SSF54695; SSF54695; 1 1: Evidence at protein level; Alternative splicing; Cytoplasm; Nucleus; Polymorphism; Reference proteome CHAIN 1..475 /note="BTB/POZ domain-containing protein 10" /id="PRO_0000228985" DOMAIN 167..241 /note="BTB" REGION 146..475 /note="Interaction with AKT family members" /evidence="ECO:0000250|UniProtKB:Q80X66" COMPBIAS 106..142 /note="Ser-rich" VAR_SEQ 1..33 /note="MAGRPHPYDGNSSDPENWDRKLHSRPRKLYKHS -> MPKDADLAFSASLFE RAESLYTLISKFFSCFCVSTLAYTKG (in isoform 2)" /evidence="ECO:0000303|PubMed:14702039" /id="VSP_055552" VARIANT 145 /note="T -> A (in dbSNP:rs34185489)" /id="VAR_033638" SEQUENCE 475 AA; 53779 MW; 0D6433891EAA33A6 CRC64; MAGRPHPYDG NSSDPENWDR KLHSRPRKLY KHSSTSSRIA KGGVDHTKMS LHGASGGHER SRDRRRSSDR SRDSSHERTE SQLTPCIRNV TSPTRQHHVE REKDHSSSRP SSPRPQKASP NGSISSAGNS SRNSSQSSSD GSCKTAGEMV FVYENAKEGA RNIRTSERVT LIVDNTRFVV DPSIFTAQPN TMLGRMFGSG REHNFTRPNE KGEYEVAEGI GSTVFRAILD YYKTGIIRCP DGISIPELRE ACDYLCISFE YSTIKCRDLS ALMHELSNDG ARRQFEFYLE EMILPLMVAS AQSGERECHI VVLTDDDVVD WDEEYPPQMG EEYSQIIYST KLYRFFKYIE NRDVAKSVLK ERGLKKIRLG IEGYPTYKEK VKKRPGGRPE VIYNYVQRPF IRMSWEKEEG KSRHVDFQCV KSKSITNLAA AAADIPQDQL VVMHPTPQVD ELDILPIHPP SGNSDLDPDA QNPML
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abcepta antibody to
info@abcepta.com, and receive a free "I Love Antibodies" mug.

Background

BTBD10 appears to behave as a suppressor of cell death, which includes neuronal cell death related to amyotrophic lateral sclerosis. It may also act as an enhancer of cell growth via its positive regulation of Akt phosphorylation.

References

??awa, M., et al. Cell. Signal. 20(3):493-505(2008)??hen, J., et al. Gene 340(1):61-69(2004)

FeedBack
Abcepta welcomes feedback from its customers.

If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abcepta.com.

$ 277.78
Cat# BP9476c
Size:
Quantity:
Availability: 2 weeks
Bulk Size

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abcepta, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900
Cedarlane Labs
+1 (800) 721-1644
+1 (336) 513-5138

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Terms & Conditions
"