CNTF, rat recombinant protein
HCNTF, CNTF, Ciliary Neurotrophic Factor.
- SPECIFICATION
- CITATIONS
- PROTOCOLS
- BACKGROUND
Primary Accession | P26441 |
---|---|
Calculated MW | 22.834 kDa |
Gene ID | 1270 |
---|---|
Gene Symbol | CNTF |
Other Names | HCNTF, CNTF, Ciliary Neurotrophic Factor. |
Gene Source | Human |
Source | E. coli |
Assay&Purity | SDS-PAGE; ≥99% |
Assay2&Purity2 | HPLC; |
Recombinant | Yes |
Sequence | AFAEQTPLTLHRRDLSSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM |
Target/Specificity | CNTF |
Application Notes | Centrifuge the vial prior to opening. Reconstitute in sterile ddH₂O or 0.4 % NaHCO₃ adjusted to pH 8-9 to a concentration ≥ 100 µg/ml. This solution can then be diluted into other aqueous buffer, preferably in the presence of carrier protein. |
Format | Lyophilized protein |
Storage | -20°C; Lyophilized from 0.025 % NaHCO₃ |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
info@abcepta.com, and receive a free "I Love Antibodies" mug.
Provided below are standard protocols that you may find useful for product applications.
Background
CNTF is a polypeptide hormone whose actions appear to be restricted to the nervous system where it promotes neurotransmitter synthesis and neurite outgrowth in certain neuronal populations. The protein is a potent survival factor for neurons and oligodendrocytes and may be relevant in reducing tissue destruction during inflammatory attacks. A mutation in this gene, which results in aberrant splicing, leads to ciliary neurotrophic factor deficiency, but this phenotype is not causally related to neurologic disease. CNTF is a survival factor for various neuronal cell types and seems to prevent the degeneration of motor axons after axotomy. CNTF Recombinant Rat produced in E.Coli is a single, non-glycosylated polypeptide chain containing 200 amino acids and having a molecular mass of 22834 Dalton. The CNTF is purified by proprietary chromatographic techniques.
References
Masiakowski P.,et al.J. Neurochem. 57:1003-1012(1991).
Negro A.,et al.Eur. J. Biochem. 201:289-294(1991).
Lam A.,et al.Gene 102:271-276(1991).
McDonald J.R.,et al.Biochim. Biophys. Acta 1090:70-80(1991).
Takahashi R.,et al.Nat. Genet. 7:79-84(1994).
If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.
If you have any additional inquiries please email technical services at tech@abcepta.com.