Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
COVID19
>   home   >   Products   >   Proteins   >   GMF-beta, human recombinant protein   

GMF-beta, human recombinant protein

Glia maturation factor beta, GMFB, GMF-B, GMF-beta, GMF

     
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
Product info
Primary Accession P60983
Calculated MW 17.0 kDa
Additional Info
Gene ID 2764
Gene Symbol GMFB
Other Names Glia maturation factor beta, GMFB, GMF-B, GMF-beta, GMF
Gene Source Human
Source E. coli
Assay&Purity SDS-PAGE; ≥98%
Assay2&Purity2 HPLC; ≥98%
Recombinant Yes
Sequence SESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFH.
Application Notes Centrifuge the vial prior to opening. Reconstitute in sterile H₂O to a concentration ≥ 100 µg/ml. This solution can then be diluted into other aqueous buffers.
Format Lyophilized protein
Storage -20°C; Lyophilized after dialysis against 20 mM PBS pH 7.4 and 130 mM NaCl.
Citations (0)
citation

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abcepta antibody to
info@abcepta.com, and receive a free "I Love Antibodies" mug.

Background

Glia Maturation Factor-Beta (GMF-Beta) is a 17 kDa protein nerve growth factor identified as a growth and differentiation factor in the vertebrate brain.Glia Maturation Factor-Beta stimulates differentiation of normal neurons as well as glial cells. GMFB inhibits the proliferation of the N-18 neuroblastoma line and the C6 glioma line while promoting their phenotypic expression. GMF-beta enhances the phenotypic expression of glia & neurons thus inhibits the proliferation of their respective tumors when added to cell culture. Cell- surface GMF-Beta acts on the target cells at close range when cells are in direct contact. GMF-Beta is produced by thymic epithelial cells and plays an important role in T cell development in favor of CD4+ T cells. GMF-Beta is a brain-specific protein which belongs to the actin-binding proteins (ADF) family. GMF-beta appears to play a role in the differentiation, maintenance, and regeneration of the nervous system. It also supports the progression of certain auto-immune diseases, possibly through its ability to induce the production and secretion of various pro-inflammatory cytokines.

References

Kaplan R.,et al.J. Neurochem. 57:483-490(1991).
Saito T.,et al.Submitted (FEB-1997) to the EMBL/GenBank/DDBJ databases.
Kalnine N.,et al.Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases.
Halleck A.,et al.Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases.
Ota T.,et al.Nat. Genet. 36:40-45(2004).

FeedBack
Abcepta welcomes feedback from its customers.

If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abcepta.com.

Discontinued
Cat# PBV10463r-10
Size:
Alternative Products:

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaMexicoNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abcepta, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Terms & Conditions
"