LIF, murine recombinant protein
Leukemia Inhibitory Factor
- SPECIFICATION
- CITATIONS
- PROTOCOLS
- BACKGROUND
Primary Accession | Q3U1H5 |
---|---|
Calculated MW | 20.0 kDa |
Gene ID | 16878 |
---|---|
Gene Symbol | LIF |
Other Names | Leukemia Inhibitory Factor, Differentiation-stimulating factor, D factor, Melanoma-derived LPL inhibitor, INN=Emfilermin |
Gene Source | Mouse |
Source | E. coli |
Assay&Purity | SDS-PAGE; ≥95% |
Assay2&Purity2 | HPLC; ≥95% |
Recombinant | Yes |
Sequence | MSPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQR KKLGCQLLGTYKQVISVVVQAF |
Application Notes | Centrifuge the vial prior to opening. Reconstitute in sterile H₂O to a concentration ≥ 100 µg/ml. This solution can then be diluted into other aqueous buffers. |
Format | Lyophilized protein |
Storage | -20°C; Lyophilized from sterile solution containing 20 mM phosphate buffer, pH 7.4 and 0.02% Tween-20 |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
info@abcepta.com, and receive a free "I Love Antibodies" mug.
Provided below are standard protocols that you may find useful for product applications.
Background
Leukemia Inhibitory Factor also called LIF is a lymphoid factor that promotes long-term maintenance of embryonic stem cells by suppressing spontaneous differentiation. Leukemia Inhibitory Factor has several functions such as cholinergic neuron differentiation, control of stem cell pluripotency, bone & fat metabolism, mitogenesis of factor dependent cell lines & promotion of megakaryocyte production in vivo. Human and mouse LIF exhibit a 78% identity in its amino acid sequence. Leukemia Inhibitory Factor (LIF) Murine Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 181 amino acids and having a molecular mass of 20 kDa. The Leukemia Inhibitory Factor (LIF) is purified by proprietary chromatographic techniques.
If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.
If you have any additional inquiries please email technical services at tech@abcepta.com.