Human recombinant protein GSTP1
Human Recombinant GSTP1
- SPECIFICATION
- CITATIONS
- PROTOCOLS
- BACKGROUND
Primary Accession | P09211 |
---|---|
Concentration | 2 |
Calculated MW | 27.6 kDa |
Gene ID | 2950 |
---|---|
Gene Symbol | GSTP1 |
Other Names | Glutathione S-transferase P, DFN7, FAEES3, GST3, PI |
Gene Source | Human |
Source | E. Coli |
Assay&Purity | SDS-PAGE; ≥95% |
Assay2&Purity2 | N/A; |
Recombinant | Yes |
Sequence | MGSSHHHHHHSSGLVPRGSHMPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ |
Format | Liquid |
Storage | -80°C; 2.0 mg/ml solution in 30% glycerol without additives. |

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
info@abcepta.com, and receive a free "I Love Antibodies" mug.
Provided below are standard protocols that you may find useful for product applications.
Background
Glutathione S-transferase P is an enzyme that in humans is encoded by the GSTP1 gene. Glutathione S-transferases (GSTs) are a family of enzymes that play an important role in detoxification by catalyzing the conjugation of many hydrophobic and electrophilic compounds with reduced glutathione. Based on their biochemical, immunologic, and structural properties, the soluble GSTs are categorized into 4 main classes: alpha, mu, pi, and theta. The glutathione S-transferase pi gene (GSTP1) is a polymorphic gene encoding active, functionally different GSTP1 variant proteins that are thought to function in xenobiotic metabolism and play a role in susceptibility to cancer, and other diseases.
References
Kano T.,et al.Cancer Res. 47:5626-5630(1987).
Cowell I.G.,et al.Biochem. J. 255:79-83(1988).
Morrow C.S.,et al.Gene 75:3-11(1989).
Moscow J.A.,et al.Cancer Res. 49:1422-1428(1989).
Bora P.S.,et al.Submitted (JUL-1994) to the EMBL/GenBank/DDBJ databases.

If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.
If you have any additional inquiries please email technical services at tech@abcepta.com.