Prepro VIP (81-122), human
Synthetic Peptide
- SPECIFICATION
- CITATIONS
- PROTOCOLS
- BACKGROUND
Primary Accession | P01282 |
---|---|
Sequence | NH2-HADGVFTSDFSKLLGQLSAKKYLESLMGKRVSSNISEDPVPV-COOH |
Gene ID | 7432 |
---|---|
Other Names | VIP peptides, Intestinal peptide PHV-42, Peptide histidine valine 42, Intestinal peptide PHM-27, Peptide histidine methioninamide 27, Vasoactive intestinal peptide, VIP, Vasoactive intestinal polypeptide, VIP |
Format | Peptides are lyophilized in a solid powder format. Peptides can be reconstituted in solution using the appropriate buffer as needed. |
Storage | Maintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C. |
Precautions | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
Name | VIP (HGNC:12693) |
---|---|
Function | [Vasoactive intestinal peptide]: VIP is a neuropeptide involved in a diverse array of physiological processes through activating the PACAP subfamily of class B1 G protein-coupled receptors: VIP receptor 1 (VPR1) and VIP receptor 2 (VPR2) (PubMed:1318039, PubMed:36385145, PubMed:8933357). Abundantly expressed throughout the CNS and peripheral nervous systems where they primarily exert neuroprotective and immune modulatory roles (PubMed:3456568). Also causes vasodilation, lowers arterial blood pressure, stimulates myocardial contractility, increases glycogenolysis and relaxes the smooth muscle of trachea, stomach and gall bladder (PubMed:15013843). |
Cellular Location | Secreted. |

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
info@abcepta.com, and receive a free "I Love Antibodies" mug.
Provided below are standard protocols that you may find useful for product applications.

If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.
If you have any additional inquiries please email technical services at tech@abcepta.com.