Foundational characteristics of cancer include proliferation, angiogenesis, migration, evasion of apoptosis, and cellular immortality. Find key markers for these cellular processes and antibodies to detect them.
The SUMOplot™ Analysis Program predicts and scores sumoylation sites in your protein. SUMOylation is a post-translational modification involved in various cellular processes, such as nuclear-cytosolic transport, transcriptional regulation, apoptosis, protein stability, response to stress, and progression through the cell cycle.
The Autophagy Receptor Motif Plotter predicts and scores autophagy receptor binding sites in your protein. Identifying proteins connected to this pathway is critical to understanding the role of autophagy in physiological as well as pathological processes such as development, differentiation, neurodegenerative diseases, stress, infection, and cancer.
Anti-Iba1 Picoband Antibody
- SPECIFICATION
- CITATIONS
- PROTOCOLS
- BACKGROUND
Application 
| WB, IHC-P |
|---|---|
| Primary Accession | P55008 |
| Host | Rabbit |
| Reactivity | Human |
| Clonality | Polyclonal |
| Format | Lyophilized |
| Description | Rabbit IgG polyclonal antibody for Allograft inflammatory factor 1(AIF1) detection. Tested with WB, IHC-P in Human. |
| Reconstitution | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
| Gene ID | 199 |
|---|---|
| Other Names | Allograft inflammatory factor 1, AIF-1, Ionized calcium-binding adapter molecule 1, Protein G1, AIF1, G1, IBA1 |
| Calculated MW | 16703 MW KDa |
| Application Details | Immunohistochemistry(Paraffin-embedded Section), 0.5-1 µg/ml, Human, By Heat Western blot, 0.1-0.5 µg/ml, Human |
| Subcellular Localization | Cytoplasm, cytoskeleton. Cell projection, ruffle membrane; Peripheral membrane protein; Cytoplasmic side. Associated with the actin cytoskeleton at membrane ruffles and at sites of phagocytosis. |
| Tissue Specificity | Detected in T-lymphocytes and peripheral blood mononuclear cells. . |
| Protein Name | Allograft inflammatory factor 1 |
| Contents | Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3. |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human Iba1 (99-133aa ETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEK), different from the related mouse sequence by seven amino acids, and from the related rat sequence by six amino acids. |
| Purification | Immunogen affinity purified. |
| Cross Reactivity | No cross reactivity with other proteins |
| Storage | At -20˚C for one year. After r˚Constitution, at 4˚C for one month. It˚Can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing. |
| Name | AIF1 |
|---|---|
| Synonyms | G1, IBA1 |
| Function | Actin-binding protein that enhances membrane ruffling and RAC activation. Enhances the actin-bundling activity of LCP1. Binds calcium. Plays a role in RAC signaling and in phagocytosis. May play a role in macrophage activation and function. Promotes the proliferation of vascular smooth muscle cells and of T-lymphocytes. Enhances lymphocyte migration. Plays a role in vascular inflammation. |
| Cellular Location | Cytoplasm, cytoskeleton {ECO:0000250|UniProtKB:O70200}. Cell projection, ruffle membrane {ECO:0000250|UniProtKB:O70200}; Peripheral membrane protein {ECO:0000250|UniProtKB:O70200}; Cytoplasmic side {ECO:0000250|UniProtKB:O70200}. Cell projection, phagocytic cup {ECO:0000250|UniProtKB:O70200}. Note=Associated with the actin cytoskeleton at membrane ruffles and at sites of phagocytosis {ECO:0000250|UniProtKB:O70200} |
| Tissue Location | Detected in T-lymphocytes and peripheral blood mononuclear cells. |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
info@abcepta.com, and receive a free "I Love Antibodies" mug.
Provided below are standard protocols that you may find useful for product applications.
Background
Allograft inflammatory factor 1 (AIF-1), also known as ionized calcium-binding adapter molecule 1(IBA1), is a protein that in humans is encoded by the AIF1 gene. This gene encodes a protein that binds actin and calcium. And this gene is induced by cytokines and interferon and may promote macrophage activation and growth of vascular smooth muscle cells and T-lymphocytes. Polymorphisms in this gene may be associated with systemic sclerosis. Alternative splicing results in multiple transcript variants, but the full-length and coding nature of some of these variants is not certain.
If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.
If you have any additional inquiries please email technical services at tech@abcepta.com.
Ordering Information
Other Products
Shipping Information
