Anti-DDAH1 Picoband Antibody
- SPECIFICATION
- CITATIONS
- PROTOCOLS
- BACKGROUND

Application
| WB |
|---|---|
| Primary Accession | O94760 |
| Host | Rabbit |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Format | Lyophilized |
| Description | Rabbit IgG polyclonal antibody for N(G),N(G)-dimethylarginine dimethylaminohydrolase 1(DDAH1) detection. Tested with WB in Human;Mouse;Rat. |
| Reconstitution | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
| Gene ID | 23576 |
|---|---|
| Other Names | N(G), N(G)-dimethylarginine dimethylaminohydrolase 1, DDAH-1, Dimethylarginine dimethylaminohydrolase 1, 3.5.3.18, DDAHI, Dimethylargininase-1, DDAH1, DDAH |
| Calculated MW | 31122 MW KDa |
| Application Details | Western blot, 0.1-0.5 µg/ml, Human, Mouse, Rat |
| Tissue Specificity | Detected in brain, liver, kidney and pancreas, and at low levels in skeletal muscle. . |
| Protein Name | N(G),N(G)-dimethylarginine dimethylaminohydrolase 1 |
| Contents | Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3. |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human DDAH1 (195-226aa QKALKIMQQMSDHRYDKLTVPDDIAANCIYLN), different from the related mouse and rat sequences by one amino acid. |
| Purification | Immunogen affinity purified. |
| Cross Reactivity | No cross reactivity with other proteins |
| Storage | At -20˚C for one year. After r˚Constitution, at 4˚C for one month. It˚Can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing. |
| Name | DDAH1 (HGNC:2715) |
|---|---|
| Synonyms | DDAH |
| Function | Hydrolyzes N(G),N(G)-dimethyl-L-arginine (ADMA) and N(G)- monomethyl-L-arginine (MMA) which act as inhibitors of NOS. Has therefore a role in the regulation of nitric oxide generation. |
| Tissue Location | Detected in brain, liver, kidney and pancreas, and at low levels in skeletal muscle. |

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
info@abcepta.com, and receive a free "I Love Antibodies" mug.
Provided below are standard protocols that you may find useful for product applications.
Background
DDAH1 is knowns as dimethylarginine dimethylaminohydrolase 1 which is mapped to chromosome 1p22 by radiation hybrid and FISH analysis. This gene belongs to the dimethylarginine dimethylaminohydrolase (DDAH) gene family. DDAH1 plays a role in nitric oxide generation by regulating cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity. It widely expressed, especially in liver and kidney.
If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.
If you have any additional inquiries please email technical services at tech@abcepta.com.





Foundational characteristics of cancer include proliferation, angiogenesis, migration, evasion of apoptosis, and cellular immortality. Find key markers for these cellular processes and antibodies to detect them.
The SUMOplot™ Analysis Program predicts and scores sumoylation sites in your protein. SUMOylation is a post-translational modification involved in various cellular processes, such as nuclear-cytosolic transport, transcriptional regulation, apoptosis, protein stability, response to stress, and progression through the cell cycle.
The Autophagy Receptor Motif Plotter predicts and scores autophagy receptor binding sites in your protein. Identifying proteins connected to this pathway is critical to understanding the role of autophagy in physiological as well as pathological processes such as development, differentiation, neurodegenerative diseases, stress, infection, and cancer.


