Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
COVID19
>   home   >   Products   >   Primary Antibodies   >   Signal Transduction   >   Anti-ALDH1B1 Picoband Antibody   

Anti-ALDH1B1 Picoband Antibody

     
  • WB - Anti-ALDH1B1 Picoband Antibody ABO11655
    Western blot analysis of ALDH1B1 expression in rat liver extract (lane 1), mouse liver extract (lane 2) and HELA whole cell lysates (lane 3). ALDH1B1 at 57KD was detected using rabbit anti- ALDH1B1 Antigen Affinity purified polyclonal antibody (Catalog # ABO11655) at 0.5 ??g/mL. The blot was developed using chemiluminescence (ECL) method .
    detail
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
  • detail
Product Information
Application
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • E=ELISA
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immuno electron microscopy
  • EIA=Enzyme Immunoassay
WB
Primary Accession P30837
Host Rabbit
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Format Lyophilized
Description Rabbit IgG polyclonal antibody for Aldehyde dehydrogenase X, mitochondrial(ALDH1B1) detection. Tested with WB in Human;Mouse;Rat.
Reconstitution Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Additional Information
Gene ID 219
Other Names Aldehyde dehydrogenase X, mitochondrial, 1.2.1.3, Aldehyde dehydrogenase 5, Aldehyde dehydrogenase family 1 member B1, ALDH1B1, ALDH5, ALDHX
Calculated MW 57206 MW KDa
Application Details Western blot, 0.1-0.5 µg/ml, Human, Mouse, Rat
Subcellular Localization Mitochondrion matrix.
Tissue Specificity Liver, testis and to a lesser extent in brain.
Protein Name Aldehyde dehydrogenase X, mitochondrial
Contents Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human ALDH1B1 (116-156aa RVYLASLETLDNGKPFQESYALDLDEVIKVYRYFAGWADK W), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids.
Purification Immunogen affinity purified.
Cross Reactivity No cross reactivity with other proteins.
Storage At -20˚C for one year. After r˚Constitution, at 4˚C for one month. It˚Can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Information
Name ALDH1B1
Synonyms ALDH5, ALDHX
Function ALDHs play a major role in the detoxification of alcohol- derived acetaldehyde. They are involved in the metabolism of corticosteroids, biogenic amines, neurotransmitters, and lipid peroxidation.
Cellular Location Mitochondrion matrix.
Tissue Location Liver, testis and to a lesser extent in brain.
Research Areas
Citations (0)
citation

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abcepta antibody to
info@abcepta.com, and receive a free "I Love Antibodies" mug.

Background

Aldehyde dehydrogenase X, mitochondrial is an enzyme that in humans is encoded by the ALDH1B1 gene. This protein belongs to the aldehyde dehydrogenases family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. This gene does not contain introns in the coding sequence. The variation of this locus may affect the development of alcohol-related problems.

FeedBack
Abcepta welcomes feedback from its customers.

If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abcepta.com.

$ 370.00
Cat# ABO11655
Size:
Quantity:
Availability: 3-5 days
Bulk Size

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaMexicoNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abcepta, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Terms & Conditions
"