Anti-ALDH1B1 Picoband Antibody
- SPECIFICATION
- CITATIONS
- PROTOCOLS
- BACKGROUND
Application ![]()
| WB |
---|---|
Primary Accession | P30837 |
Host | Rabbit |
Reactivity | Human, Mouse, Rat |
Clonality | Polyclonal |
Format | Lyophilized |
Description | Rabbit IgG polyclonal antibody for Aldehyde dehydrogenase X, mitochondrial(ALDH1B1) detection. Tested with WB in Human;Mouse;Rat. |
Reconstitution | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Gene ID | 219 |
---|---|
Other Names | Aldehyde dehydrogenase X, mitochondrial, 1.2.1.3, Aldehyde dehydrogenase 5, Aldehyde dehydrogenase family 1 member B1, ALDH1B1, ALDH5, ALDHX |
Calculated MW | 57206 MW KDa |
Application Details | Western blot, 0.1-0.5 µg/ml, Human, Mouse, Rat |
Subcellular Localization | Mitochondrion matrix. |
Tissue Specificity | Liver, testis and to a lesser extent in brain. |
Protein Name | Aldehyde dehydrogenase X, mitochondrial |
Contents | Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3. |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human ALDH1B1 (116-156aa RVYLASLETLDNGKPFQESYALDLDEVIKVYRYFAGWADK W), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids. |
Purification | Immunogen affinity purified. |
Cross Reactivity | No cross reactivity with other proteins. |
Storage | At -20˚C for one year. After r˚Constitution, at 4˚C for one month. It˚Can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing. |
Name | ALDH1B1 |
---|---|
Synonyms | ALDH5, ALDHX |
Function | ALDHs play a major role in the detoxification of alcohol- derived acetaldehyde. They are involved in the metabolism of corticosteroids, biogenic amines, neurotransmitters, and lipid peroxidation. |
Cellular Location | Mitochondrion matrix. |
Tissue Location | Liver, testis and to a lesser extent in brain. |

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
info@abcepta.com, and receive a free "I Love Antibodies" mug.
Provided below are standard protocols that you may find useful for product applications.
Background
Aldehyde dehydrogenase X, mitochondrial is an enzyme that in humans is encoded by the ALDH1B1 gene. This protein belongs to the aldehyde dehydrogenases family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. This gene does not contain introns in the coding sequence. The variation of this locus may affect the development of alcohol-related problems.

If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.
If you have any additional inquiries please email technical services at tech@abcepta.com.