Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Peptides   >   Blocking Peptides   >   TROAP Antibody(N-term) Blocking peptide   

TROAP Antibody(N-term) Blocking peptide

Synthetic peptide

     
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
Product Information
Primary Accession Q12815
Clone Names 110726258
Additional Information
Other Names Tastin, Trophinin-assisting protein, Trophinin-associated protein, TROAP
Format Peptides are lyophilized in a solid powder format. Peptides can be reconstituted in solution using the appropriate buffer as needed.
StorageMaintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.
PrecautionsThis product is for research use only. Not for use in diagnostic or therapeutic procedures.
Protein Information
Name TROAP
Function Could be involved with bystin and trophinin in a cell adhesion molecule complex that mediates an initial attachment of the blastocyst to uterine epithelial cells at the time of the embryo implantation.
Cellular Location Cytoplasm.
Tissue Location Strong expression at implantation sites. Was exclusively localized to the apical side of the syncytiotrophoblast Also found in macrophages EMBL; U04810; AAA79333.2; -; mRNA EMBL; AC125611; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; CH471111; EAW58064.1; -; Genomic_DNA EMBL; BC011597; AAH11597.1; -; mRNA EMBL; BC018627; -; NOT_ANNOTATED_CDS; mRNA EMBL; BC032583; AAH32583.1; -; mRNA CCDS; CCDS41779.1; -. [Q12815-2] CCDS; CCDS61117.1; -. [Q12815-3] CCDS; CCDS8784.1; -. [Q12815-1] PIR; I38487; I38487 RefSeq; NP_001094090.1; NM_001100620.1. [Q12815-2] RefSeq; NP_001265253.1; NM_001278324.1. [Q12815-3] RefSeq; NP_005471.3; NM_005480.3. [Q12815-1] RefSeq; XP_011536027.1; XM_011537725.2 SMR; Q12815; - BioGRID; 115341; 42 DIP; DIP-52951N; - IntAct; Q12815; 38 MINT; Q12815; - STRING; 9606.ENSP00000257909; - iPTMnet; Q12815; - PhosphoSitePlus; Q12815; - BioMuta; TROAP; - DMDM; 223634724; - EPD; Q12815; - jPOST; Q12815; - MassIVE; Q12815; - MaxQB; Q12815; - PaxDb; Q12815; - PeptideAtlas; Q12815; - PRIDE; Q12815; - ProteomicsDB; 28603; - ProteomicsDB; 58966; -. [Q12815-1] ProteomicsDB; 58967; -. [Q12815-2] Antibodypedia; 25932; 73 antibodies DNASU; 10024; - Ensembl; ENST00000257909; ENSP00000257909; ENSG00000135451. [Q12815-1] Ensembl; ENST00000380327; ENSP00000369684; ENSG00000135451. [Q12815-2] Ensembl; ENST00000548311; ENSP00000448313; ENSG00000135451. [Q12815-3] GeneID; 10024; - KEGG; hsa:10024; - UCSC; uc001rtv.5; human. [Q12815-1] CTD; 10024; - DisGeNET; 10024; - EuPathDB; HostDB:ENSG00000135451.12; - GeneCards; TROAP; - HGNC; HGNC:12327; TROAP HPA; ENSG00000135451; Tissue enhanced (bone marrow, lymphoid tissue, testis) MIM; 603872; gene neXtProt; NX_Q12815; - OpenTargets; ENSG00000135451; - PharmGKB; PA37003; - eggNOG; ENOG502S991; Eukaryota GeneTree; ENSGT00390000012132; - HOGENOM; CLU_020167_0_0_1; - InParanoid; Q12815; - PhylomeDB; Q12815; - TreeFam; TF338049; - PathwayCommons; Q12815; - BioGRID-ORCS; 10024; 30 hits in 873 CRISPR screens ChiTaRS; TROAP; human GeneWiki; TROAP; - GenomeRNAi; 10024; - Pharos; Q12815; Tbio PRO; PR:Q12815; - Proteomes; UP000005640; Chromosome 12 RNAct; Q12815; protein Bgee; ENSG00000135451; Expressed in oocyte and 154 other tissues ExpressionAtlas; Q12815; baseline and differential Genevisible; Q12815; HS GO; GO:0005737; C:cytoplasm; TAS:ProtInc GO; GO:0007155; P:cell adhesion; TAS:ProtInc InterPro; IPR026133; Tastin PANTHER; PTHR15289; PTHR15289; 3 1: Evidence at protein level; Alternative splicing; Cell adhesion; Cytoplasm; Phosphoprotein; Reference proteome; Repeat CHAIN 1..778 /note="Tastin" /id="PRO_0000065636" REPEAT 516..548 /note="1" REPEAT 549..581 /note="2" REPEAT 582..614 /note="3" REPEAT 615..647 /note="4" REGION 516..647 /note="4 X 33 AA approximate tandem repeats" COMPBIAS 504..687 /note="Cys-rich" MOD_RES 16 /note="Phosphoserine" /evidence="ECO:0000244|PubMed:18669648, ECO:0000244|PubMed:23186163" MOD_RES 98 /note="Phosphoserine" /evidence="ECO:0000244|PubMed:18691976, ECO:0000244|PubMed:23186163" MOD_RES 170 /note="Phosphoserine" /evidence="ECO:0000244|PubMed:23186163" MOD_RES 324 /note="Phosphoserine" /evidence="ECO:0000244|PubMed:18669648" MOD_RES 334 /note="Phosphoserine" /evidence="ECO:0000244|PubMed:16964243, ECO:0000244|PubMed:18669648, ECO:0000244|PubMed:18691976, ECO:0000244|PubMed:19690332, ECO:0000244|PubMed:20068231, ECO:0000244|PubMed:23186163" MOD_RES 344 /note="Phosphoserine" /evidence="ECO:0000244|PubMed:16964243" MOD_RES 362 /note="Phosphoserine" /evidence="ECO:0000244|PubMed:18669648" MOD_RES 363 /note="Phosphothreonine" /evidence="ECO:0000244|PubMed:18669648" MOD_RES 376 /note="Phosphoserine" /evidence="ECO:0000244|PubMed:18691976, ECO:0000244|PubMed:23186163" VAR_SEQ 113..778 /note="EAPGTIEFVADPAALATILSGEGVKSCHLGRQPSLAKRVLVRGSQGGTTQRV QGVRASAYLAPRTPTHRLDPARASCFSRLEGPGPRGRTLCPQRLQALISPSGPSFHPST RPSFQELRRETAGSSRTSVSQASGLLLETPVQPAFSLPKGEREVVTHSDEGGVASLGLA QRVPLRENREMSHTRDSHDSHLMPSPAPVAQPLPGHVVPCPSPFGRAQRVPSPGPPTLT SYSVLRRLTVQPKTRFTPMPSTPRVQQAQWLRGVSPQSCSEDPALPWEQVAVRLFDQES CIRSLEGSGKPPVATPSGPHSNRTPSLQEVKIQRIGILQQLLRQEVEGLVGGQCVPLNG GSSLDMVELQPLLTEISRTLNATEHNSGTSHLPGLLKHSGLPKPCLPEECGEPQPCPPA EPGPPEAFCRSEPEIPEPSLQEQLEVPEPYPPAEPRPLESCCRSEPEIPESSRQEQLEV PEPCPPAEPRPLESYCRIEPEIPESSRQEQLEVPEPCPPAEPGPLQPSTQGQSGPPGPC PRVELGASEPCTLEHRSLESSLPPCCSQWAPATTSLIFSSQHPLCASPPICSLQSLRPP AGQAGLSNLAPRTLALRERLKSCLTAIHCFHEARLDDECAFYTSRAPPSGPTRVCTNPV ATLLEWQDALCFIPVGSAAPQGSP -> GAMACTCNHSYSGG (in isoform 3)" /evidence="ECO:0000303|PubMed:15489334" /id="VSP_055063" VAR_SEQ 113..144 /note="EAPGTIEFVADPAALATILSGEGVKSCHLGRQ -> VLVPAPGKLFALRRSP FPPAKCHLARCHGLYL (in isoform 2)" /evidence="ECO:0000303|PubMed:15489334" /id="VSP_042820" VAR_SEQ 145..778 /note="Missing (in isoform 2)" /evidence="ECO:0000303|PubMed:15489334" /id="VSP_042821" CONFLICT 224 /note="R -> H (in Ref. 1; AAA79333)" /evidence="ECO:0000305" SEQUENCE 778 AA; 83857 MW; 530B0481EC8D7E02 CRC64; MTTRQATKDP LLRGVSPTPS KIPVRSQKRT PFPTVTSCAV DQENQDPRRW VQKPPLNIQR PLVDSAGPRP KARHQAETSQ RLVGISQPRN PLEELRPSPR GQNVGPGPPA QTEAPGTIEF VADPAALATI LSGEGVKSCH LGRQPSLAKR VLVRGSQGGT TQRVQGVRAS AYLAPRTPTH RLDPARASCF SRLEGPGPRG RTLCPQRLQA LISPSGPSFH PSTRPSFQEL RRETAGSSRT SVSQASGLLL ETPVQPAFSL PKGEREVVTH SDEGGVASLG LAQRVPLREN REMSHTRDSH DSHLMPSPAP VAQPLPGHVV PCPSPFGRAQ RVPSPGPPTL TSYSVLRRLT VQPKTRFTPM PSTPRVQQAQ WLRGVSPQSC SEDPALPWEQ VAVRLFDQES CIRSLEGSGK PPVATPSGPH SNRTPSLQEV KIQRIGILQQ LLRQEVEGLV GGQCVPLNGG SSLDMVELQP LLTEISRTLN ATEHNSGTSH LPGLLKHSGL PKPCLPEECG EPQPCPPAEP GPPEAFCRSE PEIPEPSLQE QLEVPEPYPP AEPRPLESCC RSEPEIPESS RQEQLEVPEP CPPAEPRPLE SYCRIEPEIP ESSRQEQLEV PEPCPPAEPG PLQPSTQGQS GPPGPCPRVE LGASEPCTLE HRSLESSLPP CCSQWAPATT SLIFSSQHPL CASPPICSLQ SLRPPAGQAG LSNLAPRTLA LRERLKSCLT AIHCFHEARL DDECAFYTSR APPSGPTRVC TNPVATLLEW QDALCFIPVG SAAPQGSP
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abcepta antibody to
info@abcepta.com, and receive a free "I Love Antibodies" mug.

Background

TROAP could be involved with bystin and trophinin in a cell adhesion molecule complex that mediates an initial attachment of the blastocyst to uterine epithelial cells at the time of the embryo implantation.

References

Yang, S., et al. FASEB J. 22(6):1960-1972(2008)Beausoleil, S.A., et al. Nat. Biotechnol. 24(10):1285-1292(2006)Nadano, D., et al. Biochem. J. 364 (PT 3), 669-677 (2002) :Suzuki, N., et al. Biol. Reprod. 60(3):621-627(1999)Suzuki, N., et al. Proc. Natl. Acad. Sci. U.S.A. 95(9):5027-5032(1998)

FeedBack
Abcepta welcomes feedback from its customers.

If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abcepta.com.

$ 277.78
Cat# BP19597a
Size:
Quantity:
Availability: 2 weeks
Bulk Size

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abcepta, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900
Cedarlane Labs
+1 (800) 721-1644
+1 (336) 513-5138

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Terms & Conditions
"