Foundational characteristics of cancer include proliferation, angiogenesis, migration, evasion of apoptosis, and cellular immortality. Find key markers for these cellular processes and antibodies to detect them.
The SUMOplot™ Analysis Program predicts and scores sumoylation sites in your protein. SUMOylation is a post-translational modification involved in various cellular processes, such as nuclear-cytosolic transport, transcriptional regulation, apoptosis, protein stability, response to stress, and progression through the cell cycle.
The Autophagy Receptor Motif Plotter predicts and scores autophagy receptor binding sites in your protein. Identifying proteins connected to this pathway is critical to understanding the role of autophagy in physiological as well as pathological processes such as development, differentiation, neurodegenerative diseases, stress, infection, and cancer.
ZNF185 Antibody(N-term) Blocking peptide
Synthetic peptide
- SPECIFICATION
- CITATIONS
- PROTOCOLS
- BACKGROUND
| Primary Accession | O15231 |
|---|---|
| Clone Names | 100406222 |
| Other Names | Zinc finger protein 185, LIM domain protein ZNF185, P1-A, ZNF185 |
|---|---|
| Format | Peptides are lyophilized in a solid powder format. Peptides can be reconstituted in solution using the appropriate buffer as needed. |
| Storage | Maintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C. |
| Precautions | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Name | ZNF185 |
|---|---|
| Function | May be involved in the regulation of cellular proliferation and/or differentiation. |
| Cellular Location | Cytoplasm, cytoskeleton. Cell junction, focal adhesion |
| Tissue Location | Expressed in placenta, pancreas and kidney. Also expressed in prostate, testis, ovary and blood EMBL; AK095258; BAC04511.1; -; mRNA EMBL; AY997296; AAY54245.1; -; mRNA EMBL; DQ508022; ABF57657.1; -; mRNA EMBL; DQ508023; ABF57658.1; -; mRNA EMBL; DQ508024; ABF57659.1; -; mRNA EMBL; DQ508025; ABF57660.1; -; mRNA EMBL; DQ508026; ABF57661.1; -; mRNA EMBL; Y09538; CAA70733.1; -; mRNA EMBL; AK296967; BAG59511.1; -; mRNA EMBL; AK301530; BAH13507.1; -; mRNA EMBL; U82671; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; CH471172; EAW72895.1; -; Genomic_DNA CCDS; CCDS48184.1; -. [O15231-1] CCDS; CCDS55528.1; -. [O15231-3] CCDS; CCDS55529.1; -. [O15231-6] CCDS; CCDS55530.1; -. [O15231-8] CCDS; CCDS55531.1; -. [O15231-4] CCDS; CCDS55532.1; -. [O15231-5] CCDS; CCDS69832.1; -. [O15231-9] RefSeq; NP_001171577.1; NM_001178106.1. [O15231-6] RefSeq; NP_001171578.1; NM_001178107.1. [O15231-8] RefSeq; NP_001171579.1; NM_001178108.1. [O15231-3] RefSeq; NP_001171580.1; NM_001178109.1. [O15231-7] RefSeq; NP_001171581.1; NM_001178110.1. [O15231-4] RefSeq; NP_001171584.1; NM_001178113.1. [O15231-5] RefSeq; NP_001171586.1; NM_001178115.1. [O15231-9] RefSeq; NP_009081.2; NM_007150.3. [O15231-1] RefSeq; XP_005274788.1; XM_005274731.2. [O15231-6] RefSeq; XP_005274792.1; XM_005274735.2. [O15231-8] RefSeq; XP_005274794.1; XM_005274737.2. [O15231-3] RefSeq; XP_005274795.1; XM_005274738.2. [O15231-1] RefSeq; XP_005274798.1; XM_005274741.2. [O15231-7] RefSeq; XP_005274802.1; XM_005274745.2. [O15231-4] BioGRID; 113525; 14 IntAct; O15231; 14 STRING; 9606.ENSP00000440847; - iPTMnet; O15231; - PhosphoSitePlus; O15231; - BioMuta; ZNF185; - EPD; O15231; - jPOST; O15231; - MassIVE; O15231; - MaxQB; O15231; - PeptideAtlas; O15231; - PRIDE; O15231; - ProteomicsDB; 24410; - ProteomicsDB; 25065; - ProteomicsDB; 30212; - ProteomicsDB; 34782; - ProteomicsDB; 48523; -. [O15231-1] ProteomicsDB; 48524; -. [O15231-2] ProteomicsDB; 48525; -. [O15231-3] ProteomicsDB; 48526; -. [O15231-4] Antibodypedia; 614; 144 antibodies DNASU; 7739; - Ensembl; ENST00000318504; ENSP00000312782; ENSG00000147394. [O15231-4] Ensembl; ENST00000318529; ENSP00000313919; ENSG00000147394. [O15231-5] Ensembl; ENST00000324823; ENSP00000325307; ENSG00000147394. [O15231-2] Ensembl; ENST00000370268; ENSP00000359291; ENSG00000147394. [O15231-1] Ensembl; ENST00000370270; ENSP00000359293; ENSG00000147394. [O15231-6] Ensembl; ENST00000449285; ENSP00000395228; ENSG00000147394. [O15231-3] Ensembl; ENST00000454925; ENSP00000392984; ENSG00000147394. [O15231-9] Ensembl; ENST00000535861; ENSP00000440847; ENSG00000147394. [O15231-6] Ensembl; ENST00000539731; ENSP00000444367; ENSG00000147394. [O15231-8] GeneID; 7739; - KEGG; hsa:7739; - UCSC; uc004fgw.5; human. [O15231-1] CTD; 7739; - DisGeNET; 7739; - EuPathDB; HostDB:ENSG00000147394.18; - GeneCards; ZNF185; - HGNC; HGNC:12976; ZNF185 HPA; ENSG00000147394; Tissue enhanced (epididymis, esophagus) MIM; 300381; gene neXtProt; NX_O15231; - OpenTargets; ENSG00000147394; - PharmGKB; PA37558; - eggNOG; KOG1704; Eukaryota GeneTree; ENSGT00530000063872; - HOGENOM; CLU_031517_0_0_1; - InParanoid; O15231; - OMA; YIHRDTI; - OrthoDB; 1419858at2759; - PhylomeDB; O15231; - TreeFam; TF335114; - PathwayCommons; O15231; - BioGRID-ORCS; 7739; 6 hits in 501 CRISPR screens ChiTaRS; ZNF185; human GenomeRNAi; 7739; - Pharos; O15231; Tbio PRO; PR:O15231; - Proteomes; UP000005640; Chromosome X RNAct; O15231; protein Bgee; ENSG00000147394; Expressed in caput epididymis and 220 other tissues ExpressionAtlas; O15231; baseline and differential Genevisible; O15231; HS GO; GO:0015629; C:actin cytoskeleton; IEA:InterPro GO; GO:0005737; C:cytoplasm; IEA:UniProtKB-KW GO; GO:0005925; C:focal adhesion; IEA:UniProtKB-SubCell GO; GO:0051015; F:actin filament binding; IEA:InterPro GO; GO:0008270; F:zinc ion binding; TAS:ProtInc InterPro; IPR030637; ZNF185 InterPro; IPR001781; Znf_LIM PANTHER; PTHR15468:SF2; PTHR15468:SF2; 1 SMART; SM00132; LIM; 1 PROSITE; PS00478; LIM_DOMAIN_1; 1 PROSITE; PS50023; LIM_DOMAIN_2; 1 1: Evidence at protein level; Alternative splicing; Cell junction; Cytoplasm; Cytoskeleton; LIM domain; Metal-binding; Phosphoprotein; Reference proteome; Zinc CHAIN 1..689 /note="Zinc finger protein 185" /id="PRO_0000075911" DOMAIN 627..689 /note="LIM zinc-binding" /evidence="ECO:0000255|PROSITE-ProRule:PRU00125" COMPBIAS 159..165 /note="Poly-Glu" MOD_RES 153 /note="Phosphoserine" /evidence="ECO:0000250|UniProtKB:Q62394" MOD_RES 447 /note="Phosphothreonine" /evidence="ECO:0000244|PubMed:23186163" MOD_RES 453 /note="Phosphoserine" /evidence="ECO:0000244|PubMed:23186163" MOD_RES 465 /note="Phosphoserine" /evidence="ECO:0000244|PubMed:23186163" VAR_SEQ 1..403 /note="MSISALGGRTKGKPLPPGEEERNNVLKQMKVRTTLKGDKSWITKQDESEGRT IELPSGRSRATSFSSAGEVPKPRPPSTRAPTGYIIRGVFTKPIDSSSQPQQQFPKANGT PKSAASLVRTANAGPPRPSSSGYKMTTEDYKKLAPYNIRRSSTSGDTEEEEEEEVVPFS SDEQKRRSEAASGVLRRTAPREHSYVLSAAKKSTGPTQETQAPFIAKRVEVVEEDGPSE KSQDPPALARSTPGSNSADGGRTKASRAIWIECLPSMPSPAGSQELSSRGEEIVRLQIL TPRAGLRLVAPDVEGMRSSPGNKDKEAPCSRELQRDLAGEEAFRAPNTDAARSSAQLSD GNVGSGATGSRPEGLAAVDIGSERGSSSATSVSAVPADRKSNSTAAQEDAKADPKG -> MAARDELGLGGDSLEAMPVPAARGRPRITNGPEELAAPSPA (in isoform 9)" /evidence="ECO:0000303|PubMed:14702039" /id="VSP_054773" VAR_SEQ 1..140 /note="Missing (in isoform 2)" /evidence="ECO:0000303|PubMed:9268636" /id="VSP_039898" VAR_SEQ 1..135 /note="Missing (in isoform 5)" /evidence="ECO:0000303|PubMed:14702039" /id="VSP_045080" VAR_SEQ 141..144 /note="YKKL -> MQRQ (in isoform 2)" /evidence="ECO:0000303|PubMed:9268636" /id="VSP_039899" VAR_SEQ 177..205 /note="RSEAASGVLRRTAPREHSYVLSAAKKSTG -> SS (in isoform 5)" /evidence="ECO:0000303|PubMed:14702039" /id="VSP_045081" VAR_SEQ 205 /note="G -> GS (in isoform 2 and isoform 3)" /evidence="ECO:0000303|PubMed:14702039, ECO:0000303|PubMed:9268636" /id="VSP_039900" VAR_SEQ 246..304 /note="Missing (in isoform 4 and isoform 5)" /evidence="ECO:0000303|PubMed:14702039, ECO:0000303|PubMed:16799630" /id="VSP_043405" VAR_SEQ 246..275 /note="Missing (in isoform 2)" /evidence="ECO:0000303|PubMed:9268636" /id="VSP_039901" VAR_SEQ 276..304 /note="Missing (in isoform 7 and isoform 8)" /evidence="ECO:0000303|PubMed:16799630" /id="VSP_047205" VAR_SEQ 305..372 /note="Missing (in isoform 2)" /evidence="ECO:0000303|PubMed:9268636" /id="VSP_039902" VAR_SEQ 372 /note="G -> GRLCAAASFASFLEDQDGHSANSQSCKPRPAAI (in isoform 6 and isoform 8)" /evidence="ECO:0000303|PubMed:16799630" /id="VSP_047206" CONFLICT 13 /note="K -> E (in Ref. 2; ABF57661)" /evidence="ECO:0000305" CONFLICT 132 /note="S -> F (in Ref. 2; ABF57661)" /evidence="ECO:0000305" CONFLICT 150 /note="R -> G (in Ref. 2; ABF57661)" /evidence="ECO:0000305" CONFLICT 236 /note="A -> V (in Ref. 3; BAH13507)" /evidence="ECO:0000305" CONFLICT 257 /note="A -> T (in Ref. 2; ABF57661)" /evidence="ECO:0000305" CONFLICT 326 /note="A -> S (in Ref. 3; BAH13507)" /evidence="ECO:0000305" CONFLICT 406 /note="A -> D (in Ref. 2; ABF57661)" /evidence="ECO:0000305" CONFLICT 408 /note="Y -> C (in Ref. 1; CAA70733)" /evidence="ECO:0000305" CONFLICT 414 /note="A -> P (in Ref. 2; ABF57657/AAY54245 and 1; CAA70733)" /evidence="ECO:0000305" CONFLICT 488 /note="Q -> H (in Ref. 2; ABF57660)" /evidence="ECO:0000305" CONFLICT 492 /note="G -> R (in Ref. 1; CAA70733)" /evidence="ECO:0000305" CONFLICT 517 /note="Q -> R (in Ref. 3; BAC04511)" /evidence="ECO:0000305" CONFLICT 621 /note="S -> F (in Ref. 2; ABF57657/AAY54245)" /evidence="ECO:0000305" MOD_RES O15231-2:66 /note="Phosphoserine" /evidence="ECO:0000244|PubMed:23186163" MOD_RES O15231-3:206 /note="Phosphoserine" /evidence="ECO:0000244|PubMed:23186163" SEQUENCE 689 AA; 73525 MW; 0CCA739701FE1423 CRC64; MSISALGGRT KGKPLPPGEE ERNNVLKQMK VRTTLKGDKS WITKQDESEG RTIELPSGRS RATSFSSAGE VPKPRPPSTR APTGYIIRGV FTKPIDSSSQ PQQQFPKANG TPKSAASLVR TANAGPPRPS SSGYKMTTED YKKLAPYNIR RSSTSGDTEE EEEEEVVPFS SDEQKRRSEA ASGVLRRTAP REHSYVLSAA KKSTGPTQET QAPFIAKRVE VVEEDGPSEK SQDPPALARS TPGSNSADGG RTKASRAIWI ECLPSMPSPA GSQELSSRGE EIVRLQILTP RAGLRLVAPD VEGMRSSPGN KDKEAPCSRE LQRDLAGEEA FRAPNTDAAR SSAQLSDGNV GSGATGSRPE GLAAVDIGSE RGSSSATSVS AVPADRKSNS TAAQEDAKAD PKGALADYEG KDVATRVGEA WQERPGAPRG GQGDPAVPAQ QPADPSTPER QSSPSGSEQL VRRESCGSSV LTDFEGKDVA TKVGEAWQDR PGAPRGGQGD PAVPTQQPAD PSTPEQQNSP SGSEQFVRRE SCTSRVRSPS SCMVTVTVTA TSEQPHIYIP APASELDSSS TTKGILFVKE YVNASEVSSG KPVSARYSNV SSIEDSFAME KKPPCGSTPY SERTTGGICT YCNREIRDCP KITLEHLGIC CHEYCFKCGI CSKPMGDLLD QIFIHRDTIH CGKCYEKLF |
Research Areas
Citations (0)
Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
Submit your citation using an Abcepta antibody to
info@abcepta.com, and receive a free "I Love Antibodies" mug.
info@abcepta.com, and receive a free "I Love Antibodies" mug.
Application Protocols
Provided below are standard protocols that you may find useful for product applications.
Background
Zinc-finger proteins bind nucleic acids and play importantroles in various cellular functions, including cell proliferation,differentiation, and apoptosis. This gene encodes a LIM-domain zincfinger protein. The LIM domain is composed of two contiguous zincfinger domains, separated by a two-amino acid residue hydrophobiclinker. The LIM domain mediates protein:protein interactions.Multiple alternatively spliced transcript variants encodingdifferent isoforms have been identified.
References
Zhang, J.S., et al. Oncogene 26(1):111-122(2007)Medina, P.P., et al. Hum. Mol. Genet. 14(7):973-982(2005)Vanaja, D.K., et al. Cancer Res. 63(14):3877-3882(2003)Mallon, A.M., et al. Genome Res. 10(6):758-775(2000)Heiss, N.S., et al. Genomics 43(3):329-338(1997)
Abcepta welcomes feedback from its customers.
If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.
If you have any additional inquiries please email technical services at tech@abcepta.com.
$ 277.78
Cat# BP19670a
Ordering Information
United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900
Other Products
Shipping Information
Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
