Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Peptides   >   Blocking Peptides   >   TGOLN2 Antibody (C-term) Blocking Peptide   

TGOLN2 Antibody (C-term) Blocking Peptide

Synthetic peptide

     
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
Product Information
Primary Accession O43493
Clone Names 90909107
Additional Information
Other Names Trans-Golgi network integral membrane protein 2, TGN38 homolog, TGN46, TGN48, Trans-Golgi network protein TGN51, TGOLN2, TGN46, TGN51
Target/Specificity The synthetic peptide sequence used to generate the antibody AP8955b was selected from the C-term region of human TGOLN2. A 10 to 100 fold molar excess to antibody is recommended. Precise conditions should be optimized for a particular assay.
Format Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 1 mg/ml.
StorageMaintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.
PrecautionsThis product is for research use only. Not for use in diagnostic or therapeutic procedures.
Protein Information
Name TGOLN2 (HGNC:15450)
Synonyms TGN46, TGN51
Function May be involved in regulating membrane traffic to and from trans-Golgi network.
Cellular Location Cell membrane; Single-pass type I membrane protein. Golgi apparatus, trans-Golgi network membrane; Single-pass type I membrane protein. Note=Primarily in trans-Golgi network. Cycles between the trans-Golgi network and the cell surface returning via endosomes
Tissue Location Isoform TGN46 is widely expressed. Isoform TGN51 is more abundant in fetal lung and kidney. Isoform TGN48 is barely expressed in embryonic kidney and promyelocytic cells EMBL; AF029316; AAB96906.1; -; Genomic_DNA EMBL; AF029313; AAB96906.1; JOINED; Genomic_DNA EMBL; AF029314; AAB96906.1; JOINED; Genomic_DNA EMBL; AF029315; AAB96906.1; JOINED; Genomic_DNA EMBL; AF029316; AAB96907.1; -; Genomic_DNA EMBL; AF029313; AAB96907.1; JOINED; Genomic_DNA EMBL; AF029314; AAB96907.1; JOINED; Genomic_DNA EMBL; AF029315; AAB96907.1; JOINED; Genomic_DNA EMBL; AF029316; AAB96908.1; -; Genomic_DNA EMBL; AF029313; AAB96908.1; JOINED; Genomic_DNA EMBL; AF029314; AAB96908.1; JOINED; Genomic_DNA EMBL; AF029315; AAB96908.1; JOINED; Genomic_DNA EMBL; U62390; AAC39539.1; -; mRNA EMBL; AF027515; AAC39541.1; -; mRNA EMBL; AF027516; AAC39542.1; -; mRNA EMBL; X94333; CAA64002.1; -; mRNA EMBL; AK126465; BAC86559.1; -; mRNA EMBL; AK222829; BAD96549.1; -; mRNA EMBL; AK223063; BAD96783.1; -; mRNA EMBL; AK312479; BAG35383.1; -; mRNA EMBL; BX640868; CAE45926.1; -; mRNA EMBL; AC093162; AAY24095.1; -; Genomic_DNA EMBL; CH471053; EAW99535.1; -; Genomic_DNA EMBL; CH471053; EAW99536.1; -; Genomic_DNA EMBL; CH471053; EAW99539.1; -; Genomic_DNA EMBL; BC008461; AAH08461.1; -; mRNA EMBL; BC028219; AAH28219.1; -; mRNA CCDS; CCDS46351.1; -. [O43493-2] CCDS; CCDS56126.1; -. [O43493-3] CCDS; CCDS56127.1; -. [O43493-4] RefSeq; NP_001193769.1; NM_001206840.1 RefSeq; NP_001193770.1; NM_001206841.1 RefSeq; NP_001193773.1; NM_001206844.1. [O43493-4] RefSeq; NP_006455.2; NM_006464.3. [O43493-2] BioGRID; 115864; 459 IntAct; O43493; 445 MINT; O43493; - STRING; 9606.ENSP00000386443; - iPTMnet; O43493; - PhosphoSitePlus; O43493; - BioMuta; TGOLN2; - EPD; O43493; - jPOST; O43493; - MassIVE; O43493; - PaxDb; O43493; - PeptideAtlas; O43493; - PRIDE; O43493; - ProteomicsDB; 30219; - ProteomicsDB; 30837; - ProteomicsDB; 48977; -. [O43493-2] ProteomicsDB; 48978; -. [O43493-3] ProteomicsDB; 48979; -. [O43493-4] ProteomicsDB; 48980; -. [O43493-5] ProteomicsDB; 48981; -. [O43493-6] Antibodypedia; 2516; 318 antibodies DNASU; 10618; - Ensembl; ENST00000377386; ENSP00000366603; ENSG00000152291. [O43493-2] Ensembl; ENST00000398263; ENSP00000381312; ENSG00000152291. [O43493-4] Ensembl; ENST00000409015; ENSP00000387035; ENSG00000152291. [O43493-7] Ensembl; ENST00000444342; ENSP00000391190; ENSG00000152291. [O43493-5] GeneID; 10618; - KEGG; hsa:10618; - UCSC; uc002soz.4; human. [O43493-2] UCSC; uc021vjw.2; human CTD; 10618; - DisGeNET; 10618; - EuPathDB; HostDB:ENSG00000152291.13; - GeneCards; TGOLN2; - HGNC; HGNC:15450; TGOLN2 HPA; ENSG00000152291; Low tissue specificity MIM; 603062; gene neXtProt; NX_O43493; - OpenTargets; ENSG00000152291; - PharmGKB; PA37959; - eggNOG; ENOG410IXPE; Eukaryota eggNOG; ENOG410XUUR; LUCA GeneTree; ENSGT00530000064712; - HOGENOM; CLU_047350_0_0_1; - InParanoid; O43493; - OrthoDB; 1481309at2759; - PhylomeDB; O43493; - TreeFam; TF332514; - Reactome; R-HSA-381426; Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs) Reactome; R-HSA-432722; Golgi Associated Vesicle Biogenesis Reactome; R-HSA-6811440; Retrograde transport at the Trans-Golgi-Network Reactome; R-HSA-8856825; Cargo recognition for clathrin-mediated endocytosis Reactome; R-HSA-8856828; Clathrin-mediated endocytosis Reactome; R-HSA-8957275; Post-translational protein phosphorylation BioGRID-ORCS; 10618; 2 hits in 790 CRISPR screens ChiTaRS; TGOLN2; human GeneWiki; TGOLN2; - GenomeRNAi; 10618; - Pharos; O43493; Tbio PRO; PR:O43493; - Proteomes; UP000005640; Chromosome 2 RNAct; O43493; protein Bgee; ENSG00000152291; Expressed in adult mammalian kidney and 244 other tissues Genevisible; O43493; HS GO; GO:0030665; C:clathrin-coated vesicle membrane; TAS:Reactome GO; GO:0005788; C:endoplasmic reticulum lumen; TAS:Reactome GO; GO:0005768; C:endosome; IBA:GO_Central GO; GO:0005794; C:Golgi apparatus; IDA:HPA GO; GO:0016021; C:integral component of membrane; IEA:UniProtKB-KW GO; GO:0005654; C:nucleoplasm; IDA:HPA GO; GO:0005886; C:plasma membrane; TAS:Reactome GO; GO:0005802; C:trans-Golgi network; IDA:MGI GO; GO:0030140; C:trans-Golgi network transport vesicle; IBA:GO_Central GO; GO:0030133; C:transport vesicle; TAS:ProtInc GO; GO:0044267; P:cellular protein metabolic process; TAS:Reactome GO; GO:0061024; P:membrane organization; TAS:Reactome GO; GO:0043687; P:post-translational protein modification; TAS:Reactome 1: Evidence at protein level; Alternative splicing; Cell membrane; Glycoprotein; Golgi apparatus; Membrane; Phosphoprotein; Polymorphism; Reference proteome; Repeat; Signal; Transmembrane; Transmembrane helix SIGNAL 1..21 /evidence="ECO:0000255" CHAIN 22..437 /note="Trans-Golgi network integral membrane protein 2" /id="PRO_0000022486" TOPO_DOM 22..381 /note="Extracellular" /evidence="ECO:0000255" TRANSMEM 382..402 /note="Helical" /evidence="ECO:0000255" TOPO_DOM 403..437 /note="Cytoplasmic" /evidence="ECO:0000255" REPEAT 54..67 /note="1" REPEAT 68..81 /note="2" REPEAT 82..95 /note="3" REPEAT 96..109 /note="4" REPEAT 110..123 /note="5" REPEAT 124..137 /note="6" REPEAT 138..151 /note="7" REPEAT 152..165 /note="8" REPEAT 166..179 /note="9" REPEAT 180..193 /note="10" REPEAT 194..207 /note="11" REPEAT 208..221 /note="12" REPEAT 222..234 /note="13" REPEAT 235..249 /note="14" REGION 54..249 /note="14 X 14 AA tandem repeats" MOTIF 395..398 /note="Endocytosis signal; in isoform TGN51" MOTIF 418..421 /note="Endocytosis signal; in isoform TGN51" MOTIF 430..433 /note="Endocytosis signal; in isoform TGN46 and isoform TGN48" MOD_RES 71 /note="Phosphoserine; by FAM20C" /evidence="ECO:0000244|PubMed:18669648, ECO:0000244|PubMed:21406692, ECO:0000244|PubMed:23186163, ECO:0000244|PubMed:24275569, ECO:0000269|PubMed:26091039" MOD_RES 221 /note="Phosphoserine; by FAM20C" /evidence="ECO:0000269|PubMed:26091039" MOD_RES 298 /note="Phosphoserine; by FAM20C" /evidence="ECO:0000244|PubMed:23186163, ECO:0000269|PubMed:26091039" MOD_RES 302 /note="Phosphothreonine; by FAM20C" /evidence="ECO:0000269|PubMed:26091039" MOD_RES 351 /note="Phosphoserine; by FAM20C" /evidence="ECO:0000244|PubMed:24275569, ECO:0000269|PubMed:26091039" CARBOHYD 39 /note="N-linked (GlcNAc...) asparagine" /evidence="ECO:0000255" CARBOHYD 82 /note="N-linked (GlcNAc...) asparagine" /evidence="ECO:0000255" CARBOHYD 96 /note="N-linked (GlcNAc...) asparagine" /evidence="ECO:0000255" CARBOHYD 152 /note="N-linked (GlcNAc...) asparagine" /evidence="ECO:0000255" CARBOHYD 180 /note="N-linked (GlcNAc...) asparagine" /evidence="ECO:0000255" CARBOHYD 208 /note="N-linked (GlcNAc...) asparagine" /evidence="ECO:0000255" CARBOHYD 222 /note="N-linked (GlcNAc...) asparagine" /evidence="ECO:0000255" CARBOHYD 373 /note="N-linked (GlcNAc...) asparagine" /evidence="ECO:0000255" CARBOHYD 377 /note="N-linked (GlcNAc...) asparagine" /evidence="ECO:0000255" VAR_SEQ 71..168 /note="Missing (in isoform 6)" /id="VSP_060318" VAR_SEQ 251..309 /note="KVVPEQPSRKDHSKPISNPSDNKELPKADTNQLADKGKLSPHAFKTESGEET DLISPPQ -> K (in isoform 4)" /id="VSP_060319" VAR_SEQ 252..309 /note="Missing (in isoform 6)" /id="VSP_060320" VAR_SEQ 437 /note="S -> VRKEEPGPWEG (in isoform 5)" /id="VSP_060321" VAR_SEQ 437 /note="S -> YVLILNVFPAPPKRSFFP (in isoform 7)" /id="VSP_060322" VAR_SEQ 437 /note="S -> IFSPPSPNRMVYSSGKR (in isoform TGN48)" /evidence="ECO:0000303|PubMed:9422759" /id="VSP_060323" VARIANT 10 /note="L -> V (in dbSNP:rs1128140)" /evidence="ECO:0000269|PubMed:9422759" /id="VAR_034724" VARIANT 86 /note="A -> G (in dbSNP:rs1044962)" /evidence="ECO:0000269|PubMed:9422759" /id="VAR_034725" VARIANT 91 /note="Q -> L (in dbSNP:rs1044963)" /evidence="ECO:0000269|PubMed:9422759" /id="VAR_034726" VARIANT 103 /note="K -> Q (in dbSNP:rs1044964)" /evidence="ECO:0000269|PubMed:9422759" /id="VAR_034727" VARIANT 105 /note="Q -> P" /evidence="ECO:0000269|PubMed:9422759" /id="VAR_034728" VARIANT 259 /note="R -> W (in dbSNP:rs4247303)" /evidence="ECO:0000269|PubMed:14702039, ECO:0000269|PubMed:8907712, ECO:0000269|Ref.4, ECO:0000269|Ref.7" /id="VAR_034729" VARIANT 322 /note="E -> G (in dbSNP:rs1044969)" /evidence="ECO:0000269|PubMed:9422759" /id="VAR_034730" MUTAGEN 430 /note="Y->A: Loss of relocalization to the trans-Golgi." /evidence="ECO:0000269|PubMed:9422759" CONFLICT 30 /note="E -> D (in Ref. 8; AAH08461)" /evidence="ECO:0000305" CONFLICT 71 /note="S -> G (in Ref. 4; BAD96549)" /evidence="ECO:0000305" CONFLICT 74 /note="A -> P (in Ref. 4; BAD96783)" /evidence="ECO:0000305" CONFLICT 158 /note="A -> P (in Ref. 1; AAB96906/AAB96907/AAB96908/ AAC39539/AAC39541/AAC39542)" /evidence="ECO:0000305" CONFLICT 386 /note="F -> S (in Ref. 5; CAE45926)" /evidence="ECO:0000305" VARIANT O43493-3:441 /note="P -> L (in dbSNP:rs4240199)" /evidence="ECO:0000305" /id="VAR_082887" CONFLICT O43493-3:439 /note="S -> F (in Ref. 1; AAC39541/AAB96907)" CONFLICT O43493-7:453 /note="F -> L (in Ref. 1; AAB96908/AAC39542)" SEQUENCE 437 AA; 45880 MW; 6F72467FED83A1A3 CRC64; MRFVVALVLL NVAAAGAVPL LATESVKQEE AGVRPSAGNV STHPSLSQRP GGSTKSHPEP QTPKDSPSKS SAEAQTPEDT PNKSGAEAKT QKDSSNKSGA EAKTQKGSTS KSGSEAQTTK DSTSKSHPEL QTPKDSTGKS GAEAQTPEDS PNRSGAEAKT QKDSPSKSGS EAQTTKDVPN KSGADGQTPK DGSSKSGAED QTPKDVPNKS GAEKQTPKDG SNKSGAEEQG PIDGPSKSGA EEQTSKDSPN KVVPEQPSRK DHSKPISNPS DNKELPKADT NQLADKGKLS PHAFKTESGE ETDLISPPQE EVKSSEPTED VEPKEAEDDD TGPEEGSPPK EEKEKMSGSA SSENREGTLS DSTGSEKDDL YPNGSGNGSA ESSHFFAYLV TAAILVAVLY IAHHNKRKII AFVLEGKRSK VTRRPKASDY QRLDQKS
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abcepta antibody to
info@abcepta.com, and receive a free "I Love Antibodies" mug.

Background

TGOLN2 may be involved in regulating membrane traffic to and from trans-Golgi network.

References

Wu,C., et.al., Proteomics 7 (11), 1775-1785 (2007)Honing,S., et.al., Mol. Cell 18 (5), 519-531 (2005)

FeedBack
Abcepta welcomes feedback from its customers.

If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abcepta.com.

$ 277.78
Cat# BP8955b
Size:
Quantity:
Availability: 2 weeks
Bulk Size

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abcepta, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900
Cedarlane Labs
+1 (800) 721-1644
+1 (336) 513-5138

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Terms & Conditions
"