VEGF120, murine recombinant protein
Vascular endothelial growth factor A, VEGF-A, Vascular permeability factor, VPF, VEGF, MGC70609, VPF
- SPECIFICATION
- CITATIONS
- PROTOCOLS
- BACKGROUND
Primary Accession | Q00731 |
---|---|
Calculated MW | 28.2 kDa |
Gene ID | 22339 |
---|---|
Gene Symbol | VEGFA |
Other Names | Vascular endothelial growth factor A, VEGF-A, Vascular permeability factor, VPF, VEGF, MGC70609. |
Gene Source | Mouse |
Source | E. coli |
Assay&Purity | SDS-PAGE; ≥97% |
Assay2&Purity2 | HPLC; ≥97% |
Recombinant | Yes |
Results | 1-5 ng/ml |
Sequence | MAPTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKCDKPRR |
Application Notes | Reconstitute the lyophilized product with sterile H₂O at a concentration of 0.1 – 0.5 mg/ml, which can be further diluted into other aqueous solutions |
Format | Lyophilized protein |
Storage | -20°C; Sterile filtered and lyophilized with no additives |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
info@abcepta.com, and receive a free "I Love Antibodies" mug.
Provided below are standard protocols that you may find useful for product applications.
Background
Vascular Endothelial Growth factor-A (VEGF-A) was originally isolated from tumor cells and is produced by a wide variety of cell types. In addition to stimulating vascular growth and permeability, VEGF-A may play a role in stimulating vasodilatation via nitric oxide-dependent pathways. Mouse VEGF-A has several variants, one being VEGF-120 (also known as VEGF-2). Recombinant Mouse VEGF-120 is a homodimer with a molecular weight of 28.2 kDa.
References
Breier G.,et al.Development 114:521-532(1992).
Claffey K.P.,et al.J. Biol. Chem. 267:16317-16322(1992).
Sugihara T.,et al.J. Biol. Chem. 273:3033-3038(1998).
Jankowsky J.A.,et al.Submitted (MAR-2003) to the EMBL/GenBank/DDBJ databases.
Church D.M.,et al.PLoS Biol. 7:E1000112-E1000112(2009).
If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.
If you have any additional inquiries please email technical services at tech@abcepta.com.