Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
COVID19
>   home   >   Products   >   Proteins   >   VEGF120, murine recombinant protein   

VEGF120, murine recombinant protein

Vascular endothelial growth factor A, VEGF-A, Vascular permeability factor, VPF, VEGF, MGC70609, VPF

     
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
Product info
Primary Accession Q00731
Calculated MW 28.2 kDa
Additional Info
Gene ID 22339
Gene Symbol VEGFA
Other Names Vascular endothelial growth factor A, VEGF-A, Vascular permeability factor, VPF, VEGF, MGC70609.
Gene Source Mouse
Source E. coli
Assay&Purity SDS-PAGE; ≥97%
Assay2&Purity2 HPLC; ≥97%
Recombinant Yes
Results 1-5 ng/ml
Sequence MAPTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKCDKPRR
Application Notes Reconstitute the lyophilized product with sterile H₂O at a concentration of 0.1 – 0.5 mg/ml, which can be further diluted into other aqueous solutions
Format Lyophilized protein
Storage -20°C; Sterile filtered and lyophilized with no additives
Citations (0)
citation

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abcepta antibody to
info@abcepta.com, and receive a free "I Love Antibodies" mug.

Background

Vascular Endothelial Growth factor-A (VEGF-A) was originally isolated from tumor cells and is produced by a wide variety of cell types. In addition to stimulating vascular growth and permeability, VEGF-A may play a role in stimulating vasodilatation via nitric oxide-dependent pathways. Mouse VEGF-A has several variants, one being VEGF-120 (also known as VEGF-2). Recombinant Mouse VEGF-120 is a homodimer with a molecular weight of 28.2 kDa.

References

Breier G.,et al.Development 114:521-532(1992).
Claffey K.P.,et al.J. Biol. Chem. 267:16317-16322(1992).
Sugihara T.,et al.J. Biol. Chem. 273:3033-3038(1998).
Jankowsky J.A.,et al.Submitted (MAR-2003) to the EMBL/GenBank/DDBJ databases.
Church D.M.,et al.PLoS Biol. 7:E1000112-E1000112(2009).

FeedBack
Abcepta welcomes feedback from its customers.

If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abcepta.com.

Discontinued
Cat# PBV10511r-10
Size:
Alternative Products:

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaMexicoNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abcepta, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Terms & Conditions
"